Lus10007889 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G17860 161 / 5e-50 Kunitz family trypsin and protease inhibitor protein (.1)
AT1G73260 121 / 3e-34 ATKTI1 ARABIDOPSIS THALIANA KUNITZ TRYPSIN INHIBITOR 1, kunitz trypsin inhibitor 1 (.1)
AT1G73325 102 / 8e-27 Kunitz family trypsin and protease inhibitor protein (.1)
AT1G73330 80 / 4e-18 ATDR4 drought-repressed 4 (.1)
AT1G72290 46 / 4e-06 Kunitz family trypsin and protease inhibitor protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10039163 377 / 3e-134 AT1G17860 167 / 4e-52 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10013770 376 / 3e-134 AT1G17860 166 / 6e-52 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10007902 371 / 3e-132 AT1G17860 162 / 3e-50 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10007890 370 / 9e-132 AT1G17860 166 / 7e-52 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10007892 366 / 3e-130 AT1G17860 163 / 1e-50 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10030354 366 / 5e-130 AT1G17860 160 / 1e-49 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10030355 260 / 3e-88 AT1G17860 149 / 5e-45 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10042301 255 / 2e-86 AT1G17860 182 / 2e-58 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10026357 254 / 4e-86 AT1G17860 181 / 6e-58 Kunitz family trypsin and protease inhibitor protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G153400 215 / 5e-71 AT1G17860 223 / 1e-74 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.017G153466 214 / 1e-70 AT1G17860 222 / 4e-74 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.017G153600 210 / 8e-69 AT1G17860 217 / 3e-72 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.004G067900 194 / 2e-62 AT1G17860 183 / 2e-58 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.004G067600 185 / 5e-59 AT1G17860 196 / 9e-64 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.017G153200 184 / 1e-58 AT1G17860 191 / 5e-62 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.004G067800 150 / 1e-45 AT1G17860 137 / 8e-41 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.001G309900 91 / 2e-22 AT1G17860 90 / 2e-22 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.019G006900 88 / 3e-21 AT1G73260 79 / 6e-18 ARABIDOPSIS THALIANA KUNITZ TRYPSIN INHIBITOR 1, kunitz trypsin inhibitor 1 (.1)
Potri.007G111800 80 / 2e-18 AT1G73260 79 / 3e-18 ARABIDOPSIS THALIANA KUNITZ TRYPSIN INHIBITOR 1, kunitz trypsin inhibitor 1 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0066 Trefoil PF00197 Kunitz_legume Trypsin and protease inhibitor
Representative CDS sequence
>Lus10007889 pacid=23143233 polypeptide=Lus10007889 locus=Lus10007889.g ID=Lus10007889.BGIv1.0 annot-version=v1.0
ATGAATACATCAGCTGCCAATGCAATGCTACTAGTCGTCTTCTATTTCTCCATCACTCTCTCTTCCACCTCCGCCGCAAGATCCCTAGCCGAAACCATTG
CCACGTCATCACTAACGCCACTACCCGTTCTAGACGTGGATGGAAAAGTGGTCCGGTCAGGGACCACTTACTACCTCCTGCCTGCAACTAGCGGGGAAGG
TGGTGGTGTAGCCTTAGCCAGCACGACCAACGACCCGGAGAGCTGCCCGTTGGCTGTTGTCCAGGACGAGGACGAGATATCCCAAGGCCTCCCGCTCACG
TTTTCCCCATTGAACACTAAGTCAGGCTACACTGTCCGCACATTCACGGACCTCAACGTTAAGTTCGCTGCAGATACGGCATGTGACGAAGGGACGGTGT
GGAAAGTCGATGACTATGATGATGATGTCGAGCAGTGGTTTGTCGGGACGGGTGGGGTGGAAGGGAACCCGGGTCCAAGGACCGTGAAAAATTGGTTTAA
GATTTGGAAGTATGGTTCGAACTATAAGTTTTCTTACTGTCCGGCAATATGCAAGTCGTGCAAGGTTGATTGCAAAGATGTTGGGATTTATGTGGACGAA
AATGGTGGGAGGAAGTTGGCTCTGGTTAGCAAGGATGCTGACCCTTTTGTGGTCAAGTTCGTGAAGGCAACTTGA
AA sequence
>Lus10007889 pacid=23143233 polypeptide=Lus10007889 locus=Lus10007889.g ID=Lus10007889.BGIv1.0 annot-version=v1.0
MNTSAANAMLLVVFYFSITLSSTSAARSLAETIATSSLTPLPVLDVDGKVVRSGTTYYLLPATSGEGGGVALASTTNDPESCPLAVVQDEDEISQGLPLT
FSPLNTKSGYTVRTFTDLNVKFAADTACDEGTVWKVDDYDDDVEQWFVGTGGVEGNPGPRTVKNWFKIWKYGSNYKFSYCPAICKSCKVDCKDVGIYVDE
NGGRKLALVSKDADPFVVKFVKAT

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G17860 Kunitz family trypsin and prot... Lus10007889 0 1
AT3G02100 UDP-Glycosyltransferase superf... Lus10015746 1.0 0.9347
AT5G47550 Cystatin/monellin superfamily ... Lus10039104 4.9 0.9285
AT1G13090 CYP71B28 "cytochrome P450, family 71, s... Lus10002670 10.4 0.9238
AT5G05340 Peroxidase superfamily protein... Lus10009937 13.2 0.9228
AT1G17860 Kunitz family trypsin and prot... Lus10039209 19.8 0.9179
AT2G14095 unknown protein Lus10001300 29.2 0.9270
AT1G17860 Kunitz family trypsin and prot... Lus10013730 29.5 0.9209
AT2G37770 ChlAKR, AKR4C9 Chloroplastic aldo-keto reduct... Lus10024354 38.2 0.8966
AT4G37390 AUR3, YDK1, GH3... YADOKARI 1, AUXIN UPREGULATED ... Lus10010391 42.1 0.9146
AT3G06490 MYB BOS1, AtMYB108 BOTRYTIS-SUSCEPTIBLE1, myb dom... Lus10037818 46.6 0.9154

Lus10007889 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.