Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G41010 87 / 5e-25 NRPE12, NRPD12, NRPB12 DNA directed RNA polymerase, 7 kDa subunit (.1) AT1G53690 63 / 2e-15 DNA directed RNA polymerase, 7 kDa subunit (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030353 [exp] 104 / 8e-32 AT5G41010 86 / 1e-24 DNA directed RNA polymerase, 7 kDa subunit (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G144800 [exp] 90 / 3e-26 AT5G41010 99 / 9e-30 DNA directed RNA polymerase, 7 kDa subunit (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0167 [flax] [poplar] Zn_Beta_Ribbon PF03604 [flax] [poplar] DNA_RNApol_7kD DNA directed RNA polymerase, 7 kDa subunit
Representative CDS sequence Show only first row Show all	>Lus10007891 pacid=23143189 polypeptide=Lus10007891 locus=Lus10007891.g ID=Lus10007891.BGIv1.0 annot-version=v1.0 ATGGATCCTCTGCCAGAGCCGGTCAGCTACATCTGCGGAGATTGTGGAACAGAGAATACTCTCAAGCCTGGCGATGTCATCCAGTGCCGAGAGTGCGGTT ACCGTATTCTCTACAAGAAGCGCACCCGCCGAAGTACTCTCCTTTCCCCCCTCTCTCAATCGTTAGTTTGA
AA sequence Show only first row Show all	>Lus10007891 pacid=23143189 polypeptide=Lus10007891 locus=Lus10007891.g ID=Lus10007891.BGIv1.0 annot-version=v1.0 MDPLPEPVSYICGDCGTENTLKPGDVIQCRECGYRILYKKRTRRSTLLSPLSQSLV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G41010		NRPE12, NRPD12,...	DNA directed RNA polymerase, 7...		Lus10007891 [exp]	0	1
					Lus10022880 [exp]	1.7	0.8747
AT5G24090		ATCHIA	chitinase A (.1)		Lus10023535 [exp]	2.0	0.8529
					Lus10009774 [exp]	3.0	0.8410
AT2G02340		ATPP2-B8	phloem protein 2-B8 (.1)		Lus10018175 [exp]	4.9	0.7946
AT5G10750			Protein of unknown function (D...		Lus10020102 [exp]	6.2	0.7882
AT4G34750			SAUR-like auxin-responsive pro...		Lus10021130 [exp]	6.9	0.7794
AT1G76140			Prolyl oligopeptidase family p...		Lus10021835 [exp]	7.3	0.7780
					Lus10016269 [exp]	7.5	0.8219
AT5G04280		AtRZ-1c	AtRZ-1c, RNA-binding (RRM/RBD/...		Lus10038683 [exp]	9.4	0.8015
AT5G53110			RING/U-box superfamily protein...		Lus10025491 [exp]	12.4	0.8146

Compare expression of checked genes

Lus10007891 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.