Lus10007892 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G17860 162 / 4e-50 Kunitz family trypsin and protease inhibitor protein (.1)
AT1G73260 117 / 2e-32 ATKTI1 ARABIDOPSIS THALIANA KUNITZ TRYPSIN INHIBITOR 1, kunitz trypsin inhibitor 1 (.1)
AT1G73325 99 / 5e-25 Kunitz family trypsin and protease inhibitor protein (.1)
AT1G73330 73 / 1e-15 ATDR4 drought-repressed 4 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10007902 424 / 8e-153 AT1G17860 162 / 3e-50 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10007890 423 / 2e-152 AT1G17860 166 / 7e-52 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10030354 413 / 1e-148 AT1G17860 160 / 1e-49 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10007889 387 / 3e-138 AT1G17860 163 / 1e-50 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10013770 387 / 3e-138 AT1G17860 166 / 6e-52 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10039163 385 / 1e-137 AT1G17860 167 / 4e-52 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10030355 254 / 1e-85 AT1G17860 149 / 5e-45 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10039210 249 / 6e-84 AT1G17860 179 / 4e-57 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10013730 246 / 8e-83 AT1G17860 175 / 2e-55 Kunitz family trypsin and protease inhibitor protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G153400 209 / 2e-68 AT1G17860 223 / 1e-74 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.017G153466 208 / 3e-68 AT1G17860 222 / 4e-74 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.017G153600 203 / 3e-66 AT1G17860 217 / 3e-72 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.004G067900 189 / 1e-60 AT1G17860 183 / 2e-58 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.004G067600 184 / 2e-58 AT1G17860 196 / 9e-64 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.017G153200 176 / 2e-55 AT1G17860 191 / 5e-62 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.004G067800 150 / 3e-45 AT1G17860 137 / 8e-41 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.019G006900 87 / 6e-21 AT1G73260 79 / 6e-18 ARABIDOPSIS THALIANA KUNITZ TRYPSIN INHIBITOR 1, kunitz trypsin inhibitor 1 (.1)
Potri.001G309900 85 / 3e-20 AT1G17860 90 / 2e-22 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.007G111800 82 / 4e-19 AT1G73260 79 / 3e-18 ARABIDOPSIS THALIANA KUNITZ TRYPSIN INHIBITOR 1, kunitz trypsin inhibitor 1 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0066 Trefoil PF00197 Kunitz_legume Trypsin and protease inhibitor
Representative CDS sequence
>Lus10007892 pacid=23143202 polypeptide=Lus10007892 locus=Lus10007892.g ID=Lus10007892.BGIv1.0 annot-version=v1.0
ATGATGATCATGAAGACCACAGCAGCAGCAACAGCAAATGCAATGCTGGTAATGGCCTTAATCGCCATCACTCTCTCTTCCGCCTACGCTGCTAGATCTC
TCGTCGAAACCCTAGCCACTTCATCCCTAACCCCACTTCCTGTCCTTGACGTGGACGGAAAAGTAGTTCGGTCAGGGACCACTTACTACGCAATCCCTGC
AACTAGCGGGGAAGGCGGTGGTGTTGCCCTAGCCAGCATGACCAAGGACCCCGAGAGCTGCCCGCAGACTGTGGTCCAAGACGAGGACGAGATTTCCCAA
GGTCTCTCTCTCACATTCGCCCCGGTCAACACCAAGTCGGGTTACACTGTTCGCACGTTCACGGACCTCAATGTCAAGTTCTCTGCTGACACTGCCTGCG
AAGAAGGGACTGTGTGGAAGGTCGATGACTTCAATGATGATGTCGAGCAGTGGTTTGTAGGTACCGGTGGGATTGAAGGGAACCCTGGGCCGAGAACCGT
GAAGAATTGGTTCAAGATTTGGAAGTACGGTTCGAACTATAAGTTGTCGTACTGTCCGGCGGTATGCAAGTCGTGCAAAGTCGATTGCAAGGATGTCGGA
ATTTACGTGGACGAGAATGGAGGAAGGAGGTTGGCTTTGGTTGACAAAGAAGCCGACCCTTTTGTGGTCAAGTTCGTCAAGGCAACTTGA
AA sequence
>Lus10007892 pacid=23143202 polypeptide=Lus10007892 locus=Lus10007892.g ID=Lus10007892.BGIv1.0 annot-version=v1.0
MMIMKTTAAATANAMLVMALIAITLSSAYAARSLVETLATSSLTPLPVLDVDGKVVRSGTTYYAIPATSGEGGGVALASMTKDPESCPQTVVQDEDEISQ
GLSLTFAPVNTKSGYTVRTFTDLNVKFSADTACEEGTVWKVDDFNDDVEQWFVGTGGIEGNPGPRTVKNWFKIWKYGSNYKLSYCPAVCKSCKVDCKDVG
IYVDENGGRRLALVDKEADPFVVKFVKAT

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G17860 Kunitz family trypsin and prot... Lus10007892 0 1
AT1G17860 Kunitz family trypsin and prot... Lus10013731 1.0 0.9946
AT1G17860 Kunitz family trypsin and prot... Lus10007902 2.0 0.9923
AT1G17860 Kunitz family trypsin and prot... Lus10039210 2.0 0.9936
AT1G17860 Kunitz family trypsin and prot... Lus10022302 2.4 0.9931
AT1G17860 Kunitz family trypsin and prot... Lus10013730 4.2 0.9842
AT5G09360 LAC14 laccase 14 (.1) Lus10006157 5.0 0.9872
AT1G17860 Kunitz family trypsin and prot... Lus10007890 5.2 0.9805
AT1G17860 Kunitz family trypsin and prot... Lus10013732 8.7 0.9712
AT3G28210 SAP12, PMZ STRESS-ASSOCIATED PROTEIN 12, ... Lus10039469 11.2 0.9815
AT1G06620 2-oxoglutarate (2OG) and Fe(II... Lus10001103 12.0 0.9745

Lus10007892 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.