Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G31880 363 / 1e-126 BRX, NIP3;1, NLM9 BREVIS RADIX, DZC (Disease resistance/zinc finger/chromosome condensation-like region) domain containing protein (.1) AT2G35600 351 / 9e-122 BRXL1, ATBRXL1, BRX-LIKE1 ARABIDOPSIS THALIANA BREVIS RADIX LIKE 1, BREVIS RADIX-like 1 (.1) AT3G14000 251 / 4e-82 ATBRXL2, BRX-LIKE2 DZC (Disease resistance/zinc finger/chromosome condensation-like region) domain containing protein (.1), DZC (Disease resistance/zinc finger/chromosome condensation-like region) domain containing protein (.2) AT1G54180 235 / 3e-76 ATBRXL3, BRX-LIKE3 ARABIDOPSIS THALIANA BREVIS RADIX-LIKE 3, BREVIS RADIX-like 3 (.1.2) AT5G20540 214 / 1e-67 ATBRXL4, BRX-LIKE4 BREVIS RADIX-like 4 (.1) AT2G21030 162 / 4e-50 unknown protein AT5G12350 89 / 7e-20 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1) AT5G19420 84 / 4e-18 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1), Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.2) AT1G69710 75 / 6e-15 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1) AT1G76950 65 / 1e-11 PRAF1 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030349 [exp] 550 / 0 AT1G31880 410 / 5e-144 BREVIS RADIX, DZC (Disease resistance/zinc finger/chromosome condensation-like region) domain containing protein (.1) Lus10017164 [exp] 221 / 3e-70 AT5G20540 457 / 1e-161 BREVIS RADIX-like 4 (.1) Lus10008459 [exp] 221 / 3e-70 AT3G14000 441 / 1e-155 DZC (Disease resistance/zinc finger/chromosome condensation-like region) domain containing protein (.1), DZC (Disease resistance/zinc finger/chromosome condensation-like region) domain containing protein (.2) Lus10000884 [exp] 218 / 3e-69 AT3G14000 439 / 3e-154 DZC (Disease resistance/zinc finger/chromosome condensation-like region) domain containing protein (.1), DZC (Disease resistance/zinc finger/chromosome condensation-like region) domain containing protein (.2) Lus10021565 [exp] 206 / 2e-64 AT5G20540 420 / 1e-146 BREVIS RADIX-like 4 (.1) Lus10028600 [exp] 84 / 9e-18 AT1G76950 1516 / 0.0 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1) Lus10018904 [exp] 83 / 2e-17 AT1G76950 1520 / 0.0 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1) Lus10036030 [exp] 82 / 2e-17 AT5G19420 1644 / 0.0 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1), Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.2) Lus10009701 [exp] 80 / 2e-16 AT5G19420 1567 / 0.0 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1), Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G101500 [exp] 397 / 1e-139 AT1G31880 434 / 8e-153 BREVIS RADIX, DZC (Disease resistance/zinc finger/chromosome condensation-like region) domain containing protein (.1) Potri.001G131800 [exp] 388 / 7e-136 AT1G31880 462 / 4e-164 BREVIS RADIX, DZC (Disease resistance/zinc finger/chromosome condensation-like region) domain containing protein (.1) Potri.006G144900 [exp] 247 / 4e-80 AT5G20540 422 / 2e-147 BREVIS RADIX-like 4 (.1) Potri.003G063200 [exp] 239 / 2e-77 AT3G14000 492 / 4e-175 DZC (Disease resistance/zinc finger/chromosome condensation-like region) domain containing protein (.1), DZC (Disease resistance/zinc finger/chromosome condensation-like region) domain containing protein (.2) Potri.018G064900 [exp] 228 / 5e-73 AT5G20540 426 / 1e-148 BREVIS RADIX-like 4 (.1) Potri.001G170800 [exp] 228 / 5e-73 AT3G14000 467 / 2e-165 DZC (Disease resistance/zinc finger/chromosome condensation-like region) domain containing protein (.1), DZC (Disease resistance/zinc finger/chromosome condensation-like region) domain containing protein (.2) Potri.005G190000 [exp] 85 / 3e-18 AT5G42140 1407 / 0.0 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1) Potri.002G070300 [exp] 84 / 6e-18 AT5G42140 1422 / 0.0 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1) Potri.001G026900 [exp] 78 / 4e-16 AT5G19420 1281 / 0.0 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1), Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.2) Potri.009G071800 [exp] 76 / 4e-15 AT5G19420 1610 / 0.0 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1), Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF08381 [flax] [poplar] BRX Transcription factor regulating root and shoot growth via Pin3
Representative CDS sequence Show only first row Show all	>Lus10007898 pacid=23143177 polypeptide=Lus10007898 locus=Lus10007898.g ID=Lus10007898.BGIv1.0 annot-version=v1.0 ATGGCATTGAAGATATCTGGCACATACAAGCAATGCAACAAGCCCTCACCAACGGGCACAAGTAGCAACTTCAGAACAGGGCATAGGCCTTATCCGGATT TCGACACAGCATCAGAAGGAGTTCCCTACCCGTATTTCGGGGCAGCAAGCTCGAGCTCAACCCCAGCATGGGACTTCCCAGGTGGTCGCCAAGGAGGAGC AGAAGATTCTCGTGATGTAGTGATCGAAGATGAAAATGGCCCAAAAGAATGGATGGCACAGGTTGAGCCTGGTGTTCACATCACATTTGTTTCTCTCCCA AATGGTGGCAATGATCTCCGACGAGTTCGCTTCAGCCGGGAGATGTTCGACAAGTGGCAAGCTCAGAGGTGGTGGGGTGAGAATTACGACAGGATCATGG AGCTTTACAATGTTCAGAGATTTAACCGTCAGTCTCTCACTACTCCTAGGTCTGAGGATGAGCAGCAAAGAGATTCAACATACTCAAAATTGGGGTCAGC AAGGGAAAGCCCCACGCCATTCACACCAAGGAACTACTACCAAGGCAGTAGCCAACAACAGCATTACCCTCATGGTCCCATGGAACCATCCAGACCAACT ACCTCATCTTCGAGAGACGAGCCTTCAATCTCCGCTAGCAATGCCAGCGAGTTGGAGACGGAATGGGTTGAGGAAGATGAGCCTGGAGTGTACATTACCA TCAGACAGCTAGCTGATGGAACAAGGGAACTCCGCAGAGTTAGATTCAGCCGTGAGAAATTTGGGGAAGTGCATGCCAAGTCATGGTGGGAGGAGAACAG AGATAGAATACAAACTCAATACTTATAG
AA sequence Show only first row Show all	>Lus10007898 pacid=23143177 polypeptide=Lus10007898 locus=Lus10007898.g ID=Lus10007898.BGIv1.0 annot-version=v1.0 MALKISGTYKQCNKPSPTGTSSNFRTGHRPYPDFDTASEGVPYPYFGAASSSSTPAWDFPGGRQGGAEDSRDVVIEDENGPKEWMAQVEPGVHITFVSLP NGGNDLRRVRFSREMFDKWQAQRWWGENYDRIMELYNVQRFNRQSLTTPRSEDEQQRDSTYSKLGSARESPTPFTPRNYYQGSSQQQHYPHGPMEPSRPT TSSSRDEPSISASNASELETEWVEEDEPGVYITIRQLADGTRELRRVRFSREKFGEVHAKSWWEENRDRIQTQYL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G31880		BRX, NIP3;1, NL...	BREVIS RADIX, DZC (Disease res...		Lus10007898 [exp]	0	1
AT2G20100	bHLH		basic helix-loop-helix (bHLH) ...		Lus10023669 [exp]	1.7	0.8983
AT3G24630			unknown protein		Lus10011100 [exp]	2.0	0.8830
AT3G02300			Regulator of chromosome conden...		Lus10030712 [exp]	2.0	0.8448
AT5G60200	DOF	TMO6, AtDof5,3	TARGET OF MONOPTEROS 6 (.1)		Lus10022373 [exp]	2.4	0.8637
AT1G79400		ATCHX2	cation/H+ exchanger 2, cation/...		Lus10005382 [exp]	5.9	0.7791
AT4G02590	bHLH	bHLH059, UNE12	unfertilized embryo sac 12, ba...		Lus10002720 [exp]	7.7	0.7821
AT4G29100	bHLH	bHLH068	basic helix-loop-helix (bHLH) ...		Lus10034940 [exp]	10.6	0.8272
AT4G31730		ATGDU1, GDU1	glutamine dumper 1 (.1)		Lus10020107 [exp]	12.5	0.8117
AT3G09550			Ankyrin repeat family protein ...		Lus10015037 [exp]	13.4	0.7988
AT2G32700		MUM1, LUH	MUCILAGE-MODIFIED 1, LEUNIG_ho...		Lus10011863 [exp]	14.7	0.8183

Compare expression of checked genes

Lus10007898 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.