Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10000121 [exp] 44 / 2e-06 AT5G17680 277 / 1e-82 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10026201 [exp] 44 / 2e-06 AT5G17680 511 / 1e-160 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10029722 [exp] 41 / 2e-05 AT5G17680 608 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10042465 [exp] 41 / 2e-05 AT5G46490 151 / 3e-40 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10005171 [exp] 40 / 3e-05 AT1G27170 576 / 0.0 transmembrane receptors;ATP binding (.1.2) Lus10028042 [exp] 40 / 6e-05 AT5G17680 145 / 2e-38 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10011741 [exp] 39 / 8e-05 AT5G36930 540 / 4e-172 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10038249 [exp] 38 / 0.0002 AT5G17680 445 / 4e-137 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10005588 [exp] 37 / 0.0004 AT5G17680 499 / 2e-156 disease resistance protein (TIR-NBS-LRR class), putative (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G069200 [exp] 46 / 4e-07 AT5G17680 590 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.017G010800 [exp] 44 / 1e-06 AT5G17680 592 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.002G056100 [exp] 42 / 6e-06 AT5G36930 591 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.019G068300 [exp] 41 / 2e-05 AT5G17680 580 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.019G070001 [exp] 40 / 3e-05 AT5G17680 481 / 5e-148 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.019G070565 [exp] 40 / 3e-05 AT5G17680 482 / 3e-148 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.005G031899 [exp] 40 / 3e-05 AT1G69550 469 / 6e-141 disease resistance protein (TIR-NBS-LRR class) (.1) Potri.019G070300 [exp] 40 / 4e-05 AT5G17680 558 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.013G037599 [exp] 40 / 4e-05 AT5G36930 627 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.001G066500 [exp] 39 / 6e-05 AT5G36930 462 / 2e-146 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10007903 pacid=23143213 polypeptide=Lus10007903 locus=Lus10007903.g ID=Lus10007903.BGIv1.0 annot-version=v1.0 ATGACAGTTTGGATCATGAGGAGCAGAGTGTGTTTCTGGACATTGCTTCCTTCTTCCGAGCAGAGTTTGGATCATGTTGGATGCTTGGCAACGGTTTCTA GCAGCAAGACTTTGGAAATGCATGATTTGGTTCAAGAACTGGGTTGGGGCATTGTGCATCAGGAGCTGGAGCCTGGACAACGTGCCATGGTGTGGACTCG TAAGGATATTTTCCGAATCTATGTCGGATGA
AA sequence Show only first row Show all	>Lus10007903 pacid=23143213 polypeptide=Lus10007903 locus=Lus10007903.g ID=Lus10007903.BGIv1.0 annot-version=v1.0 MTVWIMRSRVCFWTLLPSSEQSLDHVGCLATVSSSKTLEMHDLVQELGWGIVHQELEPGQRAMVWTRKDIFRIYVG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10007903 [exp]	0	1
AT3G24490	Trihelix		Alcohol dehydrogenase transcri...		Lus10014730 [exp]	1.4	0.8849
AT3G42150			unknown protein		Lus10031451 [exp]	4.5	0.8331
AT2G37880			Protein of unknown function, D...		Lus10021495 [exp]	4.6	0.8927
AT5G51280			DEAD-box protein abstrakt, put...		Lus10012900 [exp]	12.0	0.8644
AT1G53050			Protein kinase superfamily pro...		Lus10006800 [exp]	12.5	0.8327
AT1G24340		EMB260, EMB2421	EMBRYO DEFECTIVE 260, EMBRYO D...		Lus10006431 [exp]	13.4	0.6593
AT4G19170		CCD4, NCED4	carotenoid cleavage dioxygenas...		Lus10035700 [exp]	13.9	0.8618
AT4G03230			S-locus lectin protein kinase ...		Lus10033752 [exp]	18.4	0.7837
AT1G74670		GASA6	GA-stimulated Arabidopsis 6, G...		Lus10024216 [exp]	24.4	0.8075
AT2G25470		AtRLP21	receptor like protein 21 (.1)		Lus10027855 [exp]	26.1	0.8075

Compare expression of checked genes

Lus10007903 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.