Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G40190 141 / 2e-41 LEW3 LEAF WILTING 3, UDP-Glycosyltransferase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10014773 [exp] 176 / 6e-56 AT2G40190 188 / 1e-55 LEAF WILTING 3, UDP-Glycosyltransferase superfamily protein (.1) Lus10007500 [exp] 170 / 4e-52 AT2G40190 745 / 0.0 LEAF WILTING 3, UDP-Glycosyltransferase superfamily protein (.1) Lus10028977 [exp] 166 / 2e-50 AT2G40190 751 / 0.0 LEAF WILTING 3, UDP-Glycosyltransferase superfamily protein (.1) Lus10007501 [exp] 120 / 4e-36 AT2G40190 103 / 2e-26 LEAF WILTING 3, UDP-Glycosyltransferase superfamily protein (.1) Lus10008976 [exp] 44 / 2e-06 AT2G40190 192 / 1e-59 LEAF WILTING 3, UDP-Glycosyltransferase superfamily protein (.1) Lus10021233 [exp] 0 / 1 AT2G40190 52 / 3e-09 LEAF WILTING 3, UDP-Glycosyltransferase superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G095500 [exp] 149 / 4e-44 AT2G40190 735 / 0.0 LEAF WILTING 3, UDP-Glycosyltransferase superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10007909 pacid=23143201 polypeptide=Lus10007909 locus=Lus10007909.g ID=Lus10007909.BGIv1.0 annot-version=v1.0 ATGGCGACCGTCACTCTCCTCATTCTATATCTTCTCAGTTCTCTCATCTTCTCCTTCATCGCTTTCCTTATACTCACCTCCCGCCGGAACCGCCAAAAAG CCATCGGTTTCTTCCACCCTTACACAAATGACGGCGGCGGCAGCGAACGCGTCTTATGGTGTGCAGTCAAAGCCATTCAGGAAGAAGTCCCCGACCTCGA TTGCATCGTCTACACCGGTGATCATGACGCATCTCTTCAGTCCCTTCTCGTCCGTGGAACCGACCGATTCGACGTCCACTTGCTCCGTCCGCCGAAGGCG GTCCATCTCCACCGAAGGAAATGGGTGGAGGAGTGA
AA sequence Show only first row Show all	>Lus10007909 pacid=23143201 polypeptide=Lus10007909 locus=Lus10007909.g ID=Lus10007909.BGIv1.0 annot-version=v1.0 MATVTLLILYLLSSLIFSFIAFLILTSRRNRQKAIGFFHPYTNDGGGSERVLWCAVKAIQEEVPDLDCIVYTGDHDASLQSLLVRGTDRFDVHLLRPPKA VHLHRRKWVEE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G40190		LEW3	LEAF WILTING 3, UDP-Glycosyltr...		Lus10007909 [exp]	0	1
AT1G65450			HXXXD-type acyl-transferase fa...		Lus10029920 [exp]	2.0	0.9826
AT5G11730			Core-2/I-branching beta-1,6-N-...		Lus10034348 [exp]	2.8	0.9826
AT5G37060		ATCHX24	cation/H+ exchanger 24, ARABID...		Lus10031852 [exp]	3.5	0.9718
AT4G02340			alpha/beta-Hydrolases superfam...		Lus10008682 [exp]	3.5	0.9687
AT5G45670			GDSL-like Lipase/Acylhydrolase...		Lus10011999 [exp]	4.5	0.9672
					Lus10011637 [exp]	5.5	0.9621
AT1G52190			Major facilitator superfamily ...		Lus10008539 [exp]	6.3	0.9507
AT4G16295		SPH1	S-protein homologue 1 (.1)		Lus10029377 [exp]	7.0	0.9587
					Lus10015636 [exp]	7.2	0.8381
					Lus10034069 [exp]	7.3	0.9451

Compare expression of checked genes

Lus10007909 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.