Lus10007911 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G01490 118 / 2e-33 Heavy metal transport/detoxification superfamily protein (.1.2)
AT5G52760 59 / 3e-11 Copper transport protein family (.1)
AT5G52740 58 / 5e-11 Copper transport protein family (.1)
AT5G23760 56 / 2e-10 Copper transport protein family (.1)
AT5G52750 56 / 3e-10 Heavy metal transport/detoxification superfamily protein (.1)
AT1G63950 52 / 8e-09 Heavy metal transport/detoxification superfamily protein (.1)
AT5G26690 47 / 7e-07 Heavy metal transport/detoxification superfamily protein (.1)
AT3G05920 46 / 1e-06 Heavy metal transport/detoxification superfamily protein (.1)
AT3G06130 46 / 6e-06 Heavy metal transport/detoxification superfamily protein (.1.2)
AT1G55790 44 / 1e-05 Domain of unknown function (DUF2431) (.1), Domain of unknown function (DUF2431) (.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10036395 130 / 7e-38 AT1G01490 131 / 1e-38 Heavy metal transport/detoxification superfamily protein (.1.2)
Lus10014967 92 / 2e-23 AT1G01490 100 / 9e-27 Heavy metal transport/detoxification superfamily protein (.1.2)
Lus10027524 91 / 2e-21 AT1G01490 100 / 2e-25 Heavy metal transport/detoxification superfamily protein (.1.2)
Lus10027523 85 / 4e-21 AT1G01490 77 / 3e-19 Heavy metal transport/detoxification superfamily protein (.1.2)
Lus10039286 87 / 2e-20 AT1G01490 97 / 2e-24 Heavy metal transport/detoxification superfamily protein (.1.2)
Lus10039285 79 / 1e-18 AT1G01490 74 / 3e-17 Heavy metal transport/detoxification superfamily protein (.1.2)
Lus10027522 79 / 1e-18 AT1G01490 83 / 7e-21 Heavy metal transport/detoxification superfamily protein (.1.2)
Lus10028762 71 / 2e-15 AT1G01490 74 / 3e-17 Heavy metal transport/detoxification superfamily protein (.1.2)
Lus10024672 67 / 4e-14 AT1G01490 64 / 1e-13 Heavy metal transport/detoxification superfamily protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G163400 108 / 5e-30 AT1G01490 110 / 3e-31 Heavy metal transport/detoxification superfamily protein (.1.2)
Potri.014G089700 108 / 8e-30 AT1G01490 115 / 9e-33 Heavy metal transport/detoxification superfamily protein (.1.2)
Potri.001G099500 100 / 3e-27 AT1G01490 105 / 2e-29 Heavy metal transport/detoxification superfamily protein (.1.2)
Potri.003G132200 99 / 1e-26 AT1G01490 102 / 2e-28 Heavy metal transport/detoxification superfamily protein (.1.2)
Potri.004G073000 92 / 9e-24 AT1G01490 96 / 5e-26 Heavy metal transport/detoxification superfamily protein (.1.2)
Potri.017G147500 88 / 2e-22 AT1G01490 91 / 4e-24 Heavy metal transport/detoxification superfamily protein (.1.2)
Potri.017G147400 82 / 3e-20 AT1G01490 74 / 2e-17 Heavy metal transport/detoxification superfamily protein (.1.2)
Potri.004G073100 82 / 6e-20 AT1G01490 82 / 2e-20 Heavy metal transport/detoxification superfamily protein (.1.2)
Potri.017G147300 66 / 7e-14 AT1G01490 87 / 2e-22 Heavy metal transport/detoxification superfamily protein (.1.2)
Potri.008G220100 66 / 8e-14 AT1G01490 66 / 5e-14 Heavy metal transport/detoxification superfamily protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00403 HMA Heavy-metal-associated domain
Representative CDS sequence
>Lus10007911 pacid=23143180 polypeptide=Lus10007911 locus=Lus10007911.g ID=Lus10007911.BGIv1.0 annot-version=v1.0
ATGGTGCAGAAGGTGGTGCTGAAGCTGGATTTGCATGATGACAAGGCAAAGCAGAAGGCTTTGAAGACGGTTTCTACTCTTTCAGGAATTGATTCAATAG
CGATGGATATGAAGGAGAAGAAGATGACAGTGATAGGGACAGTGGATCCAGTAAACGTGGTGAGCAAACTCAGAAAACACTGGCCCACAACTGACATCAT
CTCTGTTGGGCCGGCGAAGGAGCCCGAGAAGAAAGAGGAGCCCAAGAAGGAAGAAGGCGCGAAGAAGGAGGAAGGCGGCTCAAATAAAGATGAGCCCAAG
AAAGAAGAAGGCGGAGACAAGAAAGACGGCGGAGGAGGAGGAGAAAAGAAAGCCGAGGAAGCCGGCGGCGGGAAGAAGGAAGAAGCTGCTGCCGGCGGCG
GTGGAGAGCAAAAAGACGGGGAGAAGAAGGAAGGCGACGGTGAGAAGAAAAAGGAGGAGCAGCCTGTGGTTGCGTTGGCGAATGTGTCCCCACAGCCGCC
ACCGGACCCGGTGTTGGAGCTTGTGAAGGCTTATAGAGCATACAATCCTCAAATGACTAGCTACTACTATGTTCAAAGTATGGAGGAGAACCCAAATGCA
TGTGTCATATCTTGA
AA sequence
>Lus10007911 pacid=23143180 polypeptide=Lus10007911 locus=Lus10007911.g ID=Lus10007911.BGIv1.0 annot-version=v1.0
MVQKVVLKLDLHDDKAKQKALKTVSTLSGIDSIAMDMKEKKMTVIGTVDPVNVVSKLRKHWPTTDIISVGPAKEPEKKEEPKKEEGAKKEEGGSNKDEPK
KEEGGDKKDGGGGGEKKAEEAGGGKKEEAAAGGGGEQKDGEKKEGDGEKKKEEQPVVALANVSPQPPPDPVLELVKAYRAYNPQMTSYYYVQSMEENPNA
CVIS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G01490 Heavy metal transport/detoxifi... Lus10007911 0 1
AT1G51760 JR3, IAR3 JASMONIC ACID RESPONSIVE 3, IA... Lus10037601 2.0 0.9137
AT4G05530 SDRA, IBR1 SHORT-CHAIN DEHYDROGENASE/REDU... Lus10020019 2.2 0.9214
AT3G53850 Uncharacterised protein family... Lus10004698 3.5 0.8808
AT5G43280 ATDCI1 "delta\(3,5\),delta\(2,4\)-die... Lus10011336 7.9 0.8937
AT4G15800 RALFL33 ralf-like 33 (.1) Lus10015172 8.5 0.8682
AT1G51760 JR3, IAR3 JASMONIC ACID RESPONSIVE 3, IA... Lus10006864 12.8 0.8929
AT5G35690 unknown protein Lus10000922 14.1 0.8697
AT4G13830 J20 DNAJ-like 20 (.1.2) Lus10016637 16.0 0.8761
AT5G23760 Copper transport protein famil... Lus10039224 16.4 0.8560
AT3G01690 alpha/beta-Hydrolases superfam... Lus10014890 16.7 0.8613

Lus10007911 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.