Plant FIBer expression Database

Lus10007943 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G11400 51 / 3e-08 ARID ARID/BRIGHT DNA-binding domain;ELM2 domain protein (.1)
AT2G46040 49 / 1e-07 ARID ARID/BRIGHT DNA-binding domain;ELM2 domain protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10014762
[exp]
206 / 2e-64 AT2G46040 242 / 4e-72 ARID/BRIGHT DNA-binding domain;ELM2 domain protein (.1)
Lus10036373
[exp]
199 / 8e-62 AT4G11400 249 / 8e-75 ARID/BRIGHT DNA-binding domain;ELM2 domain protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G086700
[exp]
84 / 7e-20 AT2G46040 247 / 2e-73 ARID/BRIGHT DNA-binding domain;ELM2 domain protein (.1)
Potri.002G161100
[exp]
74 / 2e-16 AT2G46040 221 / 4e-64 ARID/BRIGHT DNA-binding domain;ELM2 domain protein (.1)
PFAM info
Representative CDS sequence
>Lus10007943 pacid=23162339 polypeptide=Lus10007943 locus=Lus10007943.g ID=Lus10007943.BGIv1.0 annot-version=v1.0
ATGGCATCTGGTTTAACTGGAAGCATGAAAGTTGGAGATGTGGAGGATATCAAGAGTGTCTTTGTAGGAACGGATAGGATGAGGAAACATGGTGATAATG
AGGATATTGATGACATGTTGGATCTTAATGCGGTTGAGGAGTCCGTTTGTTTTCGTAATAGAAAGCAAGAGAACGCATGTCAAATACTAAATTGGGTTCG
CAGGGTTGCCCAGAATCCTTATGATTCTGCAGTTGAGAAATTACCAGAGAAGTCTAAGTGGAAGGCATACGGGATTGACAAGCTGTGGAAACAGGTTTTG
CTGGTTAGGGATGGATTGCTCGTAAAATATACGAGATCAAAAATAAAAAGTGAAATAGAAATTTAA
AA sequence
>Lus10007943 pacid=23162339 polypeptide=Lus10007943 locus=Lus10007943.g ID=Lus10007943.BGIv1.0 annot-version=v1.0
MASGLTGSMKVGDVEDIKSVFVGTDRMRKHGDNEDIDDMLDLNAVEESVCFRNRKQENACQILNWVRRVAQNPYDSAVEKLPEKSKWKAYGIDKLWKQVL
LVRDGLLVKYTRSKIKSEIEI

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G11400 ARID ARID/BRIGHT DNA-binding domain... Lus10007943
[exp]
0 1
AT5G15280 Pentatricopeptide repeat (PPR)... Lus10015373
[exp]
3.2 0.7543
AT5G15070 Phosphoglycerate mutase-like f... Lus10005263
[exp]
5.4 0.7857
AT5G55500 ATXYLT "beta-1,2-xylosyltransferase",... Lus10014902
[exp]
12.7 0.7712
AT4G13750 EMB2597, NOV NO VEIN, EMBRYO DEFECTIVE 2597... Lus10022572
[exp]
15.8 0.7761
AT2G47790 Transducin/WD40 repeat-like su... Lus10003441
[exp]
15.9 0.7532
AT3G01680 SEOR1, SEOb Sieve-Element-Occlusion-Relate... Lus10000546
[exp]
18.1 0.7611
AT1G49480 B3 REM19, RTV1 related to vernalization1 1 (.... Lus10009214
[exp]
18.2 0.7356
AT2G48110 MED33B, REF4 reduced epidermal fluorescence... Lus10042689
[exp]
20.9 0.6470
AT1G31500 DNAse I-like superfamily prote... Lus10026203
[exp]
28.5 0.7464
AT5G23540 Mov34/MPN/PAD-1 family protein... Lus10011717
[exp]
30.6 0.7451

Lus10007943 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.