Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G68040 74 / 6e-17 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1) AT5G38780 42 / 2e-05 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1) AT5G37990 41 / 5e-05 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1) AT5G37970 39 / 0.0002 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10013484 [exp] 145 / 7e-47 AT1G68040 55 / 3e-10 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G136200 [exp] 123 / 3e-35 AT1G68040 312 / 1e-104 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1) Potri.008G136300 [exp] 73 / 3e-16 AT1G68040 379 / 7e-131 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1) Potri.019G016112 [exp] 50 / 2e-08 AT1G68040 319 / 2e-107 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1) Potri.019G016102 [exp] 49 / 1e-07 AT1G68040 315 / 6e-106 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1) Potri.010G104800 [exp] 42 / 2e-05 AT1G68040 328 / 4e-111 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1) Potri.017G122950 [exp] 40 / 9e-05 AT1G15125 321 / 4e-108 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0063 [flax] [poplar] NADP_Rossmann PF03492 [flax] [poplar] Methyltransf_7 SAM dependent carboxyl methyltransferase
Representative CDS sequence Show only first row Show all	>Lus10007950 pacid=23162320 polypeptide=Lus10007950 locus=Lus10007950.g ID=Lus10007950.BGIv1.0 annot-version=v1.0 ATGCCGATCTACATGCCACCGCCGGGAGAATTCACAACCGCCGTGGCCCAAAACGGCCGCTTCACCGTAGAGACGATGGGGATGAGGAATCCGGCGCAGT GGCTGACGGGGGGAGTCCACGTGGACATGGTGGAATACACGAGCCACATCAGAGACGCCATGGAAGGAATGTTCCTCTCCCATTTCCATCCTAATGTTGT CGGATCTCTCTTGGACCAACCCGCCGTCAGGCTGTCGGAGCTGTCGGAGGAAATGGAGTCGGCTTACAAGGACAAGATTCAGGCATACTTTGTGTTACGC CGCAATTTGTTAGTACTTTGA
AA sequence Show only first row Show all	>Lus10007950 pacid=23162320 polypeptide=Lus10007950 locus=Lus10007950.g ID=Lus10007950.BGIv1.0 annot-version=v1.0 MPIYMPPPGEFTTAVAQNGRFTVETMGMRNPAQWLTGGVHVDMVEYTSHIRDAMEGMFLSHFHPNVVGSLLDQPAVRLSELSEEMESAYKDKIQAYFVLR RNLLVL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G68040			S-adenosyl-L-methionine-depend...		Lus10007950 [exp]	0	1
					Lus10027448 [exp]	2.0	0.8938
AT4G37770		ACS8	1-amino-cyclopropane-1-carboxy...		Lus10011565 [exp]	6.3	0.8337
					Lus10005748 [exp]	6.5	0.7862
AT1G69630			F-box/RNI-like superfamily pro...		Lus10023042 [exp]	9.0	0.8054
					Lus10005747 [exp]	14.1	0.7928
AT1G68320	MYB	BW62C, BW62B, A...	myb domain protein 62 (.1)		Lus10034338 [exp]	14.3	0.6996
AT1G07860			unknown protein		Lus10036143 [exp]	14.7	0.7135
					Lus10002396 [exp]	17.7	0.7144
AT2G39210			Major facilitator superfamily ...		Lus10037949 [exp]	17.7	0.6810
					Lus10004679 [exp]	18.0	0.7928

Compare expression of checked genes

Lus10007950 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.