Lus10007955 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G15140 237 / 1e-79 FAD/NAD(P)-binding oxidoreductase (.1), FAD/NAD(P)-binding oxidoreductase (.2), FAD/NAD(P)-binding oxidoreductase (.3)
AT1G20020 45 / 6e-06 ATLFNR2 ferredoxin-NADP\(+\)-oxidoreductase 2, LEAF FNR 2, ferredoxin-NADP(+)-oxidoreductase 2 (.1), ferredoxin-NADP(+)-oxidoreductase 2 (.2), ferredoxin-NADP(+)-oxidoreductase 2 (.3)
AT5G17770 41 / 0.0001 CBR1, ATCBR NADH:cytochrome B5 reductase 1 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10013488 280 / 5e-99 AT1G15140 244 / 1e-82 FAD/NAD(P)-binding oxidoreductase (.1), FAD/NAD(P)-binding oxidoreductase (.2), FAD/NAD(P)-binding oxidoreductase (.3)
Lus10035265 215 / 4e-66 AT1G15130 836 / 0.0 Endosomal targeting BRO1-like domain-containing protein (.1)
Lus10034633 187 / 5e-60 AT1G15140 316 / 3e-108 FAD/NAD(P)-binding oxidoreductase (.1), FAD/NAD(P)-binding oxidoreductase (.2), FAD/NAD(P)-binding oxidoreductase (.3)
Lus10014491 41 / 0.0001 AT5G20080 475 / 1e-170 FAD/NAD(P)-binding oxidoreductase (.1)
Lus10030059 40 / 0.0002 AT5G20080 516 / 0.0 FAD/NAD(P)-binding oxidoreductase (.1)
Lus10005682 40 / 0.0002 AT5G17770 474 / 6e-171 NADH:cytochrome B5 reductase 1 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G126700 238 / 2e-80 AT1G15140 395 / 9e-140 FAD/NAD(P)-binding oxidoreductase (.1), FAD/NAD(P)-binding oxidoreductase (.2), FAD/NAD(P)-binding oxidoreductase (.3)
Potri.010G116500 213 / 6e-70 AT1G15140 368 / 1e-128 FAD/NAD(P)-binding oxidoreductase (.1), FAD/NAD(P)-binding oxidoreductase (.2), FAD/NAD(P)-binding oxidoreductase (.3)
Potri.013G067300 44 / 1e-05 AT5G17770 461 / 6e-166 NADH:cytochrome B5 reductase 1 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0091 NAD_Ferredoxin PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Representative CDS sequence
>Lus10007955 pacid=23162303 polypeptide=Lus10007955 locus=Lus10007955.g ID=Lus10007955.BGIv1.0 annot-version=v1.0
ATGGGGAAAGGATTCGGTATCAATCAAATCGATCCGCCTGTGAAGTACTCTACCGTTCTAATTTTTGCCACCGGCTCCGGAATCAGTCCAATTCGATCTC
TAATTGAGACAGGGTTTAGTGCTGACCAAAGATCTGATGTGAGGCTTTACTATGGAGCTAGAAACCTTAAGAGGATGGCTTACCAGGATAGGTTCAAAGA
ATGGGAGTCGTCTGGTGTTAAGATTATCCCAGTACTATCACAACCAGATGGTACCTGGAAGGGTGAAGCTGGCTATGTACAGACTGCTTTCGCTAGCGCC
ACGCAGATATCCAGCCCAGCAGGCACAGGTGCTGTGCTTTGTGGGCAGAAACAGATGGCAGAGGAGGTGACATCGATTCTTTTAGCAGAGGGAGTCTCGA
CAGAGAGAATACTGAAGAACTTCTGA
AA sequence
>Lus10007955 pacid=23162303 polypeptide=Lus10007955 locus=Lus10007955.g ID=Lus10007955.BGIv1.0 annot-version=v1.0
MGKGFGINQIDPPVKYSTVLIFATGSGISPIRSLIETGFSADQRSDVRLYYGARNLKRMAYQDRFKEWESSGVKIIPVLSQPDGTWKGEAGYVQTAFASA
TQISSPAGTGAVLCGQKQMAEEVTSILLAEGVSTERILKNF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G15140 FAD/NAD(P)-binding oxidoreduct... Lus10007955 0 1
AT4G14500 Polyketide cyclase/dehydrase a... Lus10041166 2.8 0.8052
AT2G46910 Plastid-lipid associated prote... Lus10036340 4.2 0.8273
AT5G02120 PDE335, OHP PIGMENT DEFECTIVE 335, one hel... Lus10023782 11.6 0.8493
AT4G09620 Mitochondrial transcription te... Lus10009420 17.0 0.7686
Lus10027957 19.8 0.7924
AT4G28660 PSB28 photosystem II reaction center... Lus10024959 19.9 0.8159
AT5G48545 HINT3 histidine triad nucleotide-bin... Lus10025883 25.4 0.7454
AT1G56300 Chaperone DnaJ-domain superfam... Lus10020685 26.8 0.6788
AT4G14500 Polyketide cyclase/dehydrase a... Lus10021883 31.6 0.7753
AT1G72740 MYB Homeodomain-like/winged-helix ... Lus10027621 32.2 0.7298

Lus10007955 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.