Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10013500 [exp] 54 / 2e-09 AT1G73880 379 / 2e-127 UDP-glucosyl transferase 89B1 (.1) Lus10021718 [exp] 40 / 0.0001 AT1G73880 314 / 8e-105 UDP-glucosyl transferase 89B1 (.1) Lus10034650 [exp] 39 / 0.0003 AT1G73880 484 / 6e-169 UDP-glucosyl transferase 89B1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G065100 [exp] 40 / 7e-05 AT1G73880 539 / 0.0 UDP-glucosyl transferase 89B1 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10007971 pacid=23162291 polypeptide=Lus10007971 locus=Lus10007971.g ID=Lus10007971.BGIv1.0 annot-version=v1.0 ATGTCCACCGCCGTCGCCGGAGCCCACGTACTGGTATACGCATACCCGGCCGCCGGCCATATAATCCCAATACTCGACCTAACCCACTACCTACTCAGCC GTGGCCTCACCGTGACCCTCCTCCTCATCCTCCAAAGTCCACCCCCAGTCGACAGCATGGTCCACCGCCGTCGCCGGAGCCCACGTCCTGGTATATCCAT ACCCGGCCGCCGGCCATATAATCCCAATACTCGACCTAACCCACCACCTACTCAGCCGCGGCCTCACCGTGACCCTACTCCTCACTCCATCCAACCTCAA CCTCCTTCATAG
AA sequence Show only first row Show all	>Lus10007971 pacid=23162291 polypeptide=Lus10007971 locus=Lus10007971.g ID=Lus10007971.BGIv1.0 annot-version=v1.0 MSTAVAGAHVLVYAYPAAGHIIPILDLTHYLLSRGLTVTLLLILQSPPPVDSMVHRRRRSPRPGISIPGRRPYNPNTRPNPPPTQPRPHRDPTPHSIQPQ PPS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G06000			UDP-Glycosyltransferase superf...		Lus10007971 [exp]	0	1
AT1G73880		UGT89B1	UDP-glucosyl transferase 89B1 ...		Lus10007972 [exp]	1.0	0.9913
AT1G78780			pathogenesis-related family pr...		Lus10029763 [exp]	2.0	0.9907
AT3G05200		ATL6	RING/U-box superfamily protein...		Lus10004460 [exp]	4.2	0.9830
AT2G47140		AtSDR5	short-chain dehydrogenase redu...		Lus10021258 [exp]	4.5	0.9833
					Lus10040445 [exp]	7.2	0.9851
AT1G66160		ATCMPG1	"CYS, MET, PRO, and GLY protei...		Lus10040124 [exp]	9.3	0.9856
AT3G53180		NodGS	nodulin/glutamine synthase-lik...		Lus10023900 [exp]	9.3	0.9723
AT2G47140		AtSDR5	short-chain dehydrogenase redu...		Lus10013593 [exp]	10.5	0.9817
AT3G54200			Late embryogenesis abundant (L...		Lus10032671 [exp]	10.6	0.9797
AT5G06860		ATPGIP1, PGIP1	polygalacturonase inhibiting p...		Lus10023824 [exp]	11.7	0.9825

Compare expression of checked genes

Lus10007971 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.