Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G05670 51 / 1e-08 RING/U-box protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10013501 [exp] 149 / 1e-43 AT3G05670 118 / 1e-27 RING/U-box protein (.1) Lus10001831 [exp] 85 / 2e-20 AT4G23840 512 / 1e-175 Leucine-rich repeat (LRR) family protein (.1) Lus10000086 [exp] 44 / 4e-06 AT3G05670 162 / 9e-44 RING/U-box protein (.1) Lus10015213 [exp] 44 / 4e-06 AT3G05670 368 / 2e-112 RING/U-box protein (.1) Lus10031468 [exp] 40 / 9e-05 AT3G05670 343 / 2e-107 RING/U-box protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G011400 [exp] 60 / 1e-11 AT3G05670 417 / 7e-133 RING/U-box protein (.1) Potri.005G021000 [exp] 57 / 9e-11 AT3G05670 436 / 2e-140 RING/U-box protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10007973 pacid=23162301 polypeptide=Lus10007973 locus=Lus10007973.g ID=Lus10007973.BGIv1.0 annot-version=v1.0 ATGTCGTTTTGGCGTCGGTGGTTGTGGAGGCGAATCTGGGAAGGTCATCGACGTTGGCGGGCGGTCAAAAATCGTGGATATGGACGAAGAGTGGCAGGAG TGGAGAAATTTAAGGAAGTGGCGAGAGTCTCGATACATACAATGATGGCCGAATGCGGGTTGGAGCATTCGAAACGAGCCGCTATTTCAATCCCTAGCCC TGCTTGCAACCACGATGAACATAAGGCGAAATATTGTGGTAAGTCGACTCTAGGGAGCAAGTGTTGCCGAGAATGCTTTCAAGGGTTTGTAAAGGAAGTT ATTGGATTGGTTTTGTCGAAGAAATGTGATTCATGA
AA sequence Show only first row Show all	>Lus10007973 pacid=23162301 polypeptide=Lus10007973 locus=Lus10007973.g ID=Lus10007973.BGIv1.0 annot-version=v1.0 MSFWRRWLWRRIWEGHRRWRAVKNRGYGRRVAGVEKFKEVARVSIHTMMAECGLEHSKRAAISIPSPACNHDEHKAKYCGKSTLGSKCCRECFQGFVKEV IGLVLSKKCDS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G05670			RING/U-box protein (.1)		Lus10007973 [exp]	0	1
AT3G51680		AtSDR2	short-chain dehydrogenase/redu...		Lus10014227 [exp]	1.4	0.9797
					Lus10010270 [exp]	2.0	0.9754
AT2G33420			Protein of unknown function (D...		Lus10011785 [exp]	6.6	0.9410
AT3G28960			Transmembrane amino acid trans...		Lus10023029 [exp]	7.4	0.9112
AT3G12500		PR-3, PR3, CHI-...	PATHOGENESIS-RELATED 3, basic ...		Lus10041831 [exp]	8.5	0.9204
AT2G44450		BGLU15	beta glucosidase 15 (.1)		Lus10031235 [exp]	9.5	0.9368
AT3G61510		AT-ACS1, ACS1	ARABIDOPSIS THALIANA 1-AMINOCY...		Lus10007910 [exp]	9.5	0.9518
AT5G45020			Glutathione S-transferase fami...		Lus10026012 [exp]	12.4	0.9374
					Lus10039824 [exp]	13.2	0.8903
AT4G36220		CYP84A1, FAH1, ...	ferulic acid 5-hydroxylase 1 (...		Lus10000326 [exp]	17.7	0.8919

Compare expression of checked genes

Lus10007973 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.