Lus10007977 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10013504 122 / 2e-36 ND /
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10007977 pacid=23162292 polypeptide=Lus10007977 locus=Lus10007977.g ID=Lus10007977.BGIv1.0 annot-version=v1.0
ATGAACAGTGCAGGGGTGGTGGACGAATCCAGGGGAATGGATTTCTTGCTTGTTCGGTTCCCAAATCCCGTCACCATTAAGACGAGGAGGAAGAATTGTA
GAAACGGTATCGATCATCACAGCGACGGTTCGACCGTGCCACCGGAGAAGAAGGATGATCATCATGATGATGAGTACATCGAATTCTGCTTCAAACGAGA
TGGGGAATTCGAAGTTGTCAGCGACATTGCACCTCAGCCCACTGCTGACAGCACAAAGATTGAAGTGGGGAGAGATGGTGGGGAGTCCAGTGCCAATGCC
GAAAGCAGAAGCACCAGACAAGAAGAAGAATTACAGCAGAGGAAACAGAGGATTAACCGTGGTCGTTTCCGGCAGTGTTGGAGATTATGA
AA sequence
>Lus10007977 pacid=23162292 polypeptide=Lus10007977 locus=Lus10007977.g ID=Lus10007977.BGIv1.0 annot-version=v1.0
MNSAGVVDESRGMDFLLVRFPNPVTIKTRRKNCRNGIDHHSDGSTVPPEKKDDHHDDEYIEFCFKRDGEFEVVSDIAPQPTADSTKIEVGRDGGESSANA
ESRSTRQEEELQQRKQRINRGRFRQCWRL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10007977 0 1
AT3G04720 HEL, PR-4, PR4 HEVEIN-LIKE, pathogenesis-rela... Lus10005594 6.8 0.9096
AT1G27980 DPL1, ATDPL1 dihydrosphingosine phosphate l... Lus10011345 23.2 0.9066
AT2G33770 ATUBC24, UBC24,... UBIQUITIN-CONJUGATING ENZYME 2... Lus10005854 28.0 0.9011
AT5G65660 hydroxyproline-rich glycoprote... Lus10028220 28.6 0.9018
AT3G53200 MYB ATMYB27 myb domain protein 27 (.1) Lus10023918 34.0 0.8858
Lus10043397 37.5 0.8975
Lus10006284 37.6 0.8974
AT4G17030 ATHEXPBETA3.1, ... expansin-like B1 (.1) Lus10000958 38.5 0.8454
AT1G67910 unknown protein Lus10023632 40.4 0.8973
AT5G58880 unknown protein Lus10005869 45.7 0.8652

Lus10007977 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.