Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G37860 43 / 2e-06 SPT2 chromatin protein (.1) AT2G22720 36 / 0.0007 SPT2 chromatin protein (.1.2.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021143 [exp] 99 / 9e-28 AT4G37860 66 / 7e-13 SPT2 chromatin protein (.1) Lus10011581 [exp] 44 / 2e-06 AT2G22720 139 / 3e-35 SPT2 chromatin protein (.1.2.3) Lus10019243 [exp] 43 / 5e-06 AT2G22720 140 / 1e-35 SPT2 chromatin protein (.1.2.3)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G257300 [exp] 54 / 3e-10 AT4G37860 108 / 1e-26 SPT2 chromatin protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF08243 [flax] [poplar] SPT2 SPT2 chromatin protein
Representative CDS sequence Show only first row Show all	>Lus10007985 pacid=23162338 polypeptide=Lus10007985 locus=Lus10007985.g ID=Lus10007985.BGIv1.0 annot-version=v1.0 ATGTTCAATACAAGCAGGTTCGCCGGACGGGATGACAGGGATTTTGGAGCGATGGAGTCGACGTTCGAGGAGATTGGGAAAGAAGAGAGGAGGAGCGCTA AGCTTGCGAGGAAGGAGGACGCGGAAGAGCTCCGGCATCTTGTTTTGGAGGAACAAAGGGAAGAGGAGAAGAAGAGACGGTTGTCGGAGGCGGCGTCGGG GAAGAAGAGGAAATTTGCAGACTGTGATTGA
AA sequence Show only first row Show all	>Lus10007985 pacid=23162338 polypeptide=Lus10007985 locus=Lus10007985.g ID=Lus10007985.BGIv1.0 annot-version=v1.0 MFNTSRFAGRDDRDFGAMESTFEEIGKEERRSAKLARKEDAEELRHLVLEEQREEEKKRRLSEAASGKKRKFADCD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G37860			SPT2 chromatin protein (.1)		Lus10007985 [exp]	0	1
AT2G26150	HSF	ATHSFA2	heat shock transcription facto...		Lus10039134 [exp]	6.3	0.7910
					Lus10001825 [exp]	10.0	0.7758
AT5G15110			Pectate lyase family protein (...		Lus10030791 [exp]	13.3	0.7726
AT1G52560			HSP20-like chaperones superfam...		Lus10024225 [exp]	16.1	0.7680
					Lus10003825 [exp]	17.6	0.7655
					Lus10029261 [exp]	19.3	0.7655
AT5G65090		DER4, MRH3, BST...	DEFORMED ROOT HAIRS 4, BRISTLE...		Lus10041708 [exp]	19.6	0.7559
AT5G56990			unknown protein		Lus10029528 [exp]	20.8	0.7655
AT4G27420		ABCG9	ATP-binding cassette G9, ABC-2...		Lus10029635 [exp]	22.3	0.7655
AT3G12750		ZIP1	zinc transporter 1 precursor (...		Lus10014062 [exp]	23.6	0.7655

Compare expression of checked genes

Lus10007985 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.