Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10002009 [exp] 66 / 4e-14 ND / Lus10006779 [exp] 44 / 8e-07 AT5G63920 42 / 2e-05 topoisomerase 3alpha (.1) Lus10011688 [exp] 45 / 1e-06 ND / Lus10003766 [exp] 40 / 5e-05 ND 36 / 0.004 Lus10037411 [exp] 39 / 0.0002 AT2G28450 874 / 0.0 zinc finger (CCCH-type) family protein (.1), zinc finger (CCCH-type) family protein (.2) Lus10032975 [exp] 37 / 0.0004 ND 40 / 1e-04
Poplar homologues Show only best Show top 10	No hit found
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0167 [flax] [poplar] Zn_Beta_Ribbon PF06839 [flax] [poplar] zf-GRF GRF zinc finger
Representative CDS sequence Show only first row Show all	>Lus10007992 pacid=23164434 polypeptide=Lus10007992 locus=Lus10007992.g ID=Lus10007992.BGIv1.0 annot-version=v1.0 ATGGGTCGTTCTCTACCTCACCAGAATTACGGCGATTCGAGCTCCTCGAAGCTAGGTCAGTCGAGTAGATTTCTTAGCGCCAGCGTTGAGAAGAGCTATC ATGGATACGATGTCATGATTAAGGTTGAAGGTACAGTAGCTAATCGAGGAAGACCGTTTTTGAGGTGTCCACTATGGGAAGGTTCAACAGATTGTGGTTT CTTTTGTTATATCGAGCATGGGCAAGCGAGGGTTGTTAAATATGAAGCTAAGGTTGATGGAGGGAAAGCTTCAAATGCACTGTCTTACTGTGCAGTTGGA AGTCCTTAA
AA sequence Show only first row Show all	>Lus10007992 pacid=23164434 polypeptide=Lus10007992 locus=Lus10007992.g ID=Lus10007992.BGIv1.0 annot-version=v1.0 MGRSLPHQNYGDSSSSKLGQSSRFLSASVEKSYHGYDVMIKVEGTVANRGRPFLRCPLWEGSTDCGFFCYIEHGQARVVKYEAKVDGGKASNALSYCAVG SP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10007992 [exp]	0	1
AT5G65660			hydroxyproline-rich glycoprote...		Lus10032818 [exp]	1.0	0.9213
AT1G58848			Disease resistance protein (CC...		Lus10028076 [exp]	1.7	0.8892
AT3G57170			N-acetylglucosaminyl transfera...		Lus10003248 [exp]	2.4	0.8988
AT3G62950			Thioredoxin superfamily protei...		Lus10040898 [exp]	2.8	0.8553
AT2G16700		ADF5, ATADF5	actin depolymerizing factor 5 ...		Lus10025049 [exp]	3.6	0.8203
AT1G15520		ATABCG40, ABCG4...	Arabidopsis thaliana ATP-bindi...		Lus10022663 [exp]	4.2	0.8613
AT1G32400		TOM2A	tobamovirus multiplication 2A ...		Lus10040108 [exp]	4.6	0.8562
AT5G23850			Arabidopsis thaliana protein o...		Lus10037863 [exp]	5.3	0.8174
AT4G17250			unknown protein		Lus10000731 [exp]	5.5	0.8448
AT3G07310			Protein of unknown function (D...		Lus10038208 [exp]	5.5	0.8741

Compare expression of checked genes

Lus10007992 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.