Lus10007995 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G26210 224 / 1e-76 Mitochondrial ATP synthase subunit G protein (.1.2)
AT4G29480 221 / 3e-75 Mitochondrial ATP synthase subunit G protein (.1)
AT2G19680 217 / 1e-73 Mitochondrial ATP synthase subunit G protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10040553 251 / 4e-87 AT4G26210 228 / 9e-79 Mitochondrial ATP synthase subunit G protein (.1.2)
Lus10040544 251 / 4e-87 AT4G26210 228 / 9e-79 Mitochondrial ATP synthase subunit G protein (.1.2)
Lus10001771 246 / 3e-85 AT4G26210 224 / 3e-77 Mitochondrial ATP synthase subunit G protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G055700 223 / 2e-76 AT4G26210 210 / 9e-72 Mitochondrial ATP synthase subunit G protein (.1.2)
Potri.006G232000 214 / 1e-72 AT4G29480 212 / 2e-72 Mitochondrial ATP synthase subunit G protein (.1)
Potri.006G231900 207 / 9e-70 AT4G29480 181 / 3e-60 Mitochondrial ATP synthase subunit G protein (.1)
Potri.018G055501 129 / 5e-39 AT2G19680 130 / 2e-40 Mitochondrial ATP synthase subunit G protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04718 ATP-synt_G Mitochondrial ATP synthase g subunit
Representative CDS sequence
>Lus10007995 pacid=23164443 polypeptide=Lus10007995 locus=Lus10007995.g ID=Lus10007995.BGIv1.0 annot-version=v1.0
ATGGCGCTGGCGATCGTGCTTTTAGCTTCTTTGAAATTGCTTTTTGGCTGTGGGATTTTATGGATCTTGAGGCAGATGATATTTTATATTCCTGTTTGTA
GGGATTTGAATCTTTTTCCGGCACCATTTCAGGTCTTGGAACTGATGGCGTCCAAATTAATGCAATTGCAATCTAAAGCTTGCCAAGCGTCTAAGTTTGT
GTCTAAGCATGGCACTACCTACTACAAACAGTTACTGGAACAGAACAAGAAATACATTCAGGAGCCCGCTAGTGTTGAGAAGTGCAATGAATTGTCTAAG
CAATTGTTTTACACTCGGCTAGCCAGTATCCCAGGTAGAAATGAAGCATTCTGGAAGGAGCTAGATTATGTGAAGAACTTGTGGAAGAACAGGCAAGAGC
TAAAGGTTGAGGATGCAGGGGTTGCTGCATTGTTTGGACTTGAGTGCTTCGCATGGTATTGTGCTGGTGAAATCATAGGGAGGGGAGTCACCTTCACCGG
CTACTACCCTTGA
AA sequence
>Lus10007995 pacid=23164443 polypeptide=Lus10007995 locus=Lus10007995.g ID=Lus10007995.BGIv1.0 annot-version=v1.0
MALAIVLLASLKLLFGCGILWILRQMIFYIPVCRDLNLFPAPFQVLELMASKLMQLQSKACQASKFVSKHGTTYYKQLLEQNKKYIQEPASVEKCNELSK
QLFYTRLASIPGRNEAFWKELDYVKNLWKNRQELKVEDAGVAALFGLECFAWYCAGEIIGRGVTFTGYYP

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G26210 Mitochondrial ATP synthase sub... Lus10007995 0 1
AT4G26210 Mitochondrial ATP synthase sub... Lus10001771 1.7 0.9457
AT5G20500 Glutaredoxin family protein (.... Lus10017148 6.2 0.9170
AT4G11260 RPR1, ETA3, EDM... ENHANCER OF TIR1-1 AUXIN RESIS... Lus10027540 8.5 0.8997
AT5G16950 unknown protein Lus10021093 10.6 0.8895
AT5G61970 signal recognition particle-re... Lus10032538 13.4 0.8959
AT3G25220 FKBP15-1 FK506-binding protein 15 kD-1 ... Lus10003170 13.5 0.8896
AT5G47570 unknown protein Lus10000735 14.7 0.8786
AT3G52300 ATPQ "ATP synthase D chain, mitocho... Lus10023492 17.3 0.8892
AT3G60540 Preprotein translocase Sec, Se... Lus10011428 18.7 0.8898
AT1G56450 PBG1 20S proteasome beta subunit G1... Lus10036124 19.0 0.8877

Lus10007995 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.