Lus10008000 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G11800 127 / 4e-34 ATKEA6, KEA6 K+ efflux antiporter 6, ARABIDOPSIS THALIANA K+ EFFLUX ANTIPORTER 6, K+ efflux antiporter 6 (.1)
AT2G19600 126 / 1e-33 ATKEA4 K+ efflux antiporter 4, K+ efflux antiporter 4, K+ efflux antiporter 4 (.1)
AT5G51710 117 / 1e-30 ATKEA5, KEA5 K+ efflux antiporter 5, ARABIDOPSIS THALIANA K+ EFFLUX ANTIPORTER 5, K+ efflux antiporter 5 (.1), K+ efflux antiporter 5 (.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10040549 145 / 8e-41 AT2G19600 851 / 0.0 K+ efflux antiporter 4, K+ efflux antiporter 4, K+ efflux antiporter 4 (.1)
Lus10008002 130 / 3e-35 AT2G19600 781 / 0.0 K+ efflux antiporter 4, K+ efflux antiporter 4, K+ efflux antiporter 4 (.1)
Lus10031687 108 / 2e-27 AT5G51710 833 / 0.0 K+ efflux antiporter 5, ARABIDOPSIS THALIANA K+ EFFLUX ANTIPORTER 5, K+ efflux antiporter 5 (.1), K+ efflux antiporter 5 (.2)
Lus10031106 108 / 3e-27 AT5G51710 907 / 0.0 K+ efflux antiporter 5, ARABIDOPSIS THALIANA K+ EFFLUX ANTIPORTER 5, K+ efflux antiporter 5 (.1), K+ efflux antiporter 5 (.2)
Lus10027602 76 / 5e-17 ND /
Lus10036316 65 / 3e-12 ND 42 / 4e-04
Lus10007999 62 / 2e-11 AT2G19600 569 / 0.0 K+ efflux antiporter 4, K+ efflux antiporter 4, K+ efflux antiporter 4 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G230400 135 / 5e-37 AT5G11800 731 / 0.0 K+ efflux antiporter 6, ARABIDOPSIS THALIANA K+ EFFLUX ANTIPORTER 6, K+ efflux antiporter 6 (.1)
Potri.018G054100 135 / 6e-37 AT5G11800 740 / 0.0 K+ efflux antiporter 6, ARABIDOPSIS THALIANA K+ EFFLUX ANTIPORTER 6, K+ efflux antiporter 6 (.1)
Potri.015G132400 123 / 9e-33 AT5G51710 791 / 0.0 K+ efflux antiporter 5, ARABIDOPSIS THALIANA K+ EFFLUX ANTIPORTER 5, K+ efflux antiporter 5 (.1), K+ efflux antiporter 5 (.2)
Potri.012G130500 120 / 2e-31 AT5G51710 830 / 0.0 K+ efflux antiporter 5, ARABIDOPSIS THALIANA K+ EFFLUX ANTIPORTER 5, K+ efflux antiporter 5 (.1), K+ efflux antiporter 5 (.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0064 CPA_AT PF00999 Na_H_Exchanger Sodium/hydrogen exchanger family
Representative CDS sequence
>Lus10008000 pacid=23164438 polypeptide=Lus10008000 locus=Lus10008000.g ID=Lus10008000.BGIv1.0 annot-version=v1.0
ATGGTGAAAAATACCAAACTTGCAACAACCCGAGTTGATTCAGAGCTTGGTGGTCATGCTACATCTATAGCATACTCTGACAATATTGGTTGTCATAACA
TGGAGGAGACCTCACATTATGTTGGTCACCAACTAGAGGAAGATGTAGATGATAACAAGGCTGAAGACGTACCTGGAAATGATAGTGAGGCATCAAGCGA
GGATGATGATGGTTCCTACATTGGGGAGATGCATCCTAATGAAGAGGATTTTAATGTCGAGTTGGGAGGAGTAGGGGCATCATCGTCTCATGCCCCTCCA
AGAGAGTTGACACCCTTTGACAAGTTGGGTCTCAGCCTTGAACTAGGATCATTTGCTGCAGGTGTGATGATATCCACGACTGATCTTGCCCACCATACAC
TCGAGCAAGTAGAACCAATTCGAAACTTCTTTGCAGCTCTGTTCTTGGCAAGCATTGGGATGTTGATAGATGTCCATTTCTTATGGAATCATGTTGATAT
ACTACTTGCTTCGGTACTGTTAGTGATTGTTGTCAAAACTATTATTACTGCGTCTGTTGTCAAGGGATTTGGATACAACAATAAGACTGCACTTCTTATA
TTTCCTAGTTAG
AA sequence
>Lus10008000 pacid=23164438 polypeptide=Lus10008000 locus=Lus10008000.g ID=Lus10008000.BGIv1.0 annot-version=v1.0
MVKNTKLATTRVDSELGGHATSIAYSDNIGCHNMEETSHYVGHQLEEDVDDNKAEDVPGNDSEASSEDDDGSYIGEMHPNEEDFNVELGGVGASSSHAPP
RELTPFDKLGLSLELGSFAAGVMISTTDLAHHTLEQVEPIRNFFAALFLASIGMLIDVHFLWNHVDILLASVLLVIVVKTIITASVVKGFGYNNKTALLI
FPS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G51710 ATKEA5, KEA5 K+ efflux antiporter 5, ARABID... Lus10008000 0 1
Lus10014737 3.0 0.9920
AT1G04520 PDLP2 plasmodesmata-located protein ... Lus10028049 4.2 0.9920
AT3G04060 NAC ANAC046 NAC domain containing protein ... Lus10033699 5.2 0.9920
AT4G16195 Plant self-incompatibility pro... Lus10019768 6.0 0.9920
Lus10021773 6.7 0.9920
AT4G27170 SESA4, AT2S4 seed storage albumin 4 (.1) Lus10040395 7.3 0.9920
Lus10039552 7.9 0.9920
AT1G08510 FATB fatty acyl-ACP thioesterases B... Lus10035900 8.5 0.9920
Lus10019558 9.0 0.9920
Lus10012677 10.0 0.9820

Lus10008000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.