Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10008005 pacid=23161777 polypeptide=Lus10008005 locus=Lus10008005.g ID=Lus10008005.BGIv1.0 annot-version=v1.0 ATGGACATAAGTAACCCAGGTGCTGTGAATGACGAATCATTGGATTACCTTCCTCAAGTGACGGATAAGAAGCTTGAAGCTGTAGCATCTATTGAGAATT GCAAAGATGACAGAGATATTCGTTTAGTGGTGGTTCTCTCTTCTACTCAGTCGGACGAGGAATTGGATGATGTGTCAGAAGAGGATGAGACTGACAATAT GCTGGTGGAGAATGAAGACGAGGAAATCAACTCAATAGAACCTAATGTTGAAGATGAGTTCTTATCGGCTCTTGAGTTCTTGTAG
AA sequence Show only first row Show all	>Lus10008005 pacid=23161777 polypeptide=Lus10008005 locus=Lus10008005.g ID=Lus10008005.BGIv1.0 annot-version=v1.0 MDISNPGAVNDESLDYLPQVTDKKLEAVASIENCKDDRDIRLVVVLSSTQSDEELDDVSEEDETDNMLVENEDEEINSIEPNVEDEFLSALEFL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10008005 [exp]	0	1
AT5G20990		B73, CNX1, SIR4...	SIRTINOL 4, CO-FACTOR FOR NITR...		Lus10000717 [exp]	2.4	0.8028
AT2G26695			Ran BP2/NZF zinc finger-like s...		Lus10033023 [exp]	4.0	0.7889
AT1G07360	C3HZnF	MAC5A	MOS4-associated complex subuni...		Lus10012448 [exp]	4.9	0.7878
AT4G39050			Kinesin motor family protein (...		Lus10017906 [exp]	6.0	0.7333
AT1G47890		AtRLP7	receptor like protein 7 (.1)		Lus10004309 [exp]	7.2	0.7870
AT5G14610			DEAD box RNA helicase family p...		Lus10035149 [exp]	7.4	0.7720
AT1G06050			Protein of unknown function (D...		Lus10005308 [exp]	12.2	0.6730
AT1G72200			RING/U-box superfamily protein...		Lus10041134 [exp]	13.0	0.7329
AT3G18990	B3	REM39, VRN1	REDUCED VERNALIZATION RESPONSE...		Lus10035637 [exp]	14.7	0.7662
AT5G06060			NAD(P)-binding Rossmann-fold s...		Lus10040731 [exp]	22.7	0.7273

Compare expression of checked genes

Lus10008005 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.