Lus10008008 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10008008 pacid=23161776 polypeptide=Lus10008008 locus=Lus10008008.g ID=Lus10008008.BGIv1.0 annot-version=v1.0
ATGTCCCCTTTTCAAGTCACTAAGGACGAAAACCAAGCTGAGATTCTTGATCAACAAGTTGATCGACTGGATAAGGAGGGTCAACCTGCTAAAGTTAATG
TTGAGGGCCAGGGAGAACTATTTGATATTGAAGAAAATGTGGATGAAGAGATCATTATCGATGATAGGGTATTCATGAAGAGTACGGCTGGTGCTTCACC
ACAGTCTGTTTCGACTGCATCAAGTGATGGCCCCTACGCAGTTAAGCCTACATTTGGGAACTATCTCAGTCACAGTAAGATACTGCCAAAACGTGGTCGT
GGTAGAGGAGGCAAAAAAGAGGGGAAAATGTAA
AA sequence
>Lus10008008 pacid=23161776 polypeptide=Lus10008008 locus=Lus10008008.g ID=Lus10008008.BGIv1.0 annot-version=v1.0
MSPFQVTKDENQAEILDQQVDRLDKEGQPAKVNVEGQGELFDIEENVDEEIIIDDRVFMKSTAGASPQSVSTASSDGPYAVKPTFGNYLSHSKILPKRGR
GRGGKKEGKM

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10008008 0 1
Lus10006401 12.8 0.8411
AT4G24910 Protein of unknown function (D... Lus10002345 23.8 0.8346
AT4G23610 Late embryogenesis abundant (L... Lus10027179 26.6 0.8268
Lus10041251 30.5 0.8257
AT5G17390 Adenine nucleotide alpha hydro... Lus10034661 33.3 0.8213
AT1G31490 HXXXD-type acyl-transferase fa... Lus10023806 37.5 0.8212
AT2G28790 Pathogenesis-related thaumatin... Lus10040843 41.7 0.8040
AT2G17270 PHT3;3 phosphate transporter 3;3 (.1) Lus10035975 47.1 0.8164
AT2G38600 HAD superfamily, subfamily III... Lus10017060 49.5 0.7894
AT4G38400 ATEXPL2, ATHEXP... EXPANSIN L2, expansin-like A2 ... Lus10025116 56.9 0.7898

Lus10008008 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.