Lus10008009 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G04780 195 / 2e-65 MED21 mediator 21 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10024509 241 / 2e-83 AT4G04780 201 / 9e-68 mediator 21 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G017100 204 / 6e-69 AT4G04780 207 / 2e-70 mediator 21 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF11221 Med21 Subunit 21 of Mediator complex
Representative CDS sequence
>Lus10008009 pacid=23161781 polypeptide=Lus10008009 locus=Lus10008009.g ID=Lus10008009.BGIv1.0 annot-version=v1.0
ATGGATATAATTTCCCAATTACAAGAACAAATCGATACGGTGGCTTCTCTTGCTTTTAACTCCATCGGAACGTTGCAGAGAGATGCTCCGCCAGTGCGGC
TGTCGTCCAATTACCCTGAGCCACCGCCAGCCCCTGTCAACCCTTCAGAGGATATTGCTGAGCAGCCTAAGCAGATGGGCACTGCTCTCGTCAAAGCTGC
TAAGCAGTTTGATGCTCTGGTGGCTGCACTTCCACTGTCCGAGGGTGGTGAAGAAGCTCAATTGAAAAGGATTGCTGAGCTGCAGGCTGAAAACGATGCT
GTAGGTCAAGAACTCCAGAAGCAACTTGAAGCTGCTGAAAAAGAGTTGAAACAGGTTGTGGAGCTATTTGGTCAAGCGACAGACAATTGCTTGAACCTGA
AGAAACCAGATTAG
AA sequence
>Lus10008009 pacid=23161781 polypeptide=Lus10008009 locus=Lus10008009.g ID=Lus10008009.BGIv1.0 annot-version=v1.0
MDIISQLQEQIDTVASLAFNSIGTLQRDAPPVRLSSNYPEPPPAPVNPSEDIAEQPKQMGTALVKAAKQFDALVAALPLSEGGEEAQLKRIAELQAENDA
VGQELQKQLEAAEKELKQVVELFGQATDNCLNLKKPD

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G04780 MED21 mediator 21 (.1) Lus10008009 0 1
AT4G28240 Wound-responsive family protei... Lus10018535 6.9 0.8021
AT1G71950 Proteinase inhibitor, propepti... Lus10038252 7.8 0.8170
AT1G68220 Protein of unknown function (D... Lus10043484 13.7 0.7971
AT2G17350 unknown protein Lus10013847 13.7 0.8026
AT3G60300 RWD domain-containing protein ... Lus10009773 16.4 0.8161
AT1G13570 F-box/RNI-like superfamily pro... Lus10016297 20.6 0.8128
AT4G16530 Family of unknown function (DU... Lus10000730 21.3 0.7847
AT5G39360 EDL2 EID1-like 2 (.1) Lus10025639 23.2 0.8070
AT2G17350 unknown protein Lus10026564 26.5 0.8121
AT3G20870 ZTP29 zinc transporter 29, ZIP metal... Lus10031268 27.4 0.7825

Lus10008009 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.