Lus10008011 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10008011 pacid=23161775 polypeptide=Lus10008011 locus=Lus10008011.g ID=Lus10008011.BGIv1.0 annot-version=v1.0
ATGGGTGGTGGTGCATGGCCGTTCTTAGTTGGTGGAGCGATTTGTCTGGTTAATTCCGTTAACGAACGAGACCTCAGCCTGCTAACTAGCTATGCGGAGG
CATCCTCCGTGGCCAGCTTCTTAGAGGGACTATGGCCTTTTAGGCCAAGGAAGTTTGAGGCAATAACAGGTCTGTGA
AA sequence
>Lus10008011 pacid=23161775 polypeptide=Lus10008011 locus=Lus10008011.g ID=Lus10008011.BGIv1.0 annot-version=v1.0
MGGGAWPFLVGGAICLVNSVNERDLSLLTSYAEASSVASFLEGLWPFRPRKFEAITGL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10008011 0 1
Lus10000298 1.4 0.9761
Lus10007186 2.0 0.9662
Lus10001550 2.4 0.9657
Lus10039450 3.5 0.8973
Lus10007187 4.5 0.8889
AT1G11340 S-locus lectin protein kinase ... Lus10002717 4.9 0.8659
Lus10030678 5.3 0.8647
AT5G46030 unknown protein Lus10025438 17.5 0.8135
AT1G26660 Prefoldin chaperone subunit fa... Lus10026631 18.0 0.8099
AT1G25260 Ribosomal protein L10 family p... Lus10001072 25.1 0.8106

Lus10008011 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.