Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042777 [exp] 63 / 2e-13 AT3G44630 136 / 2e-36 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2), Disease resistance protein (TIR-NBS-LRR class) family (.3) Lus10008209 [exp] 59 / 2e-12 AT4G19510 107 / 8e-28 Disease resistance protein (TIR-NBS-LRR class) (.1), Disease resistance protein (TIR-NBS-LRR class) (.2) Lus10017419 [exp] 59 / 6e-12 AT4G12010 272 / 9e-80 Disease resistance protein (TIR-NBS-LRR class) family (.1) Lus10007030 [exp] 56 / 8e-11 AT4G12010 316 / 3e-94 Disease resistance protein (TIR-NBS-LRR class) family (.1) Lus10017418 [exp] 56 / 1e-10 AT5G44510 335 / 1e-96 target of AVRB operation1 (.1) Lus10010222 [exp] 54 / 3e-10 AT4G11170 169 / 2e-47 Disease resistance protein (TIR-NBS-LRR class) family (.1) Lus10015648 [exp] 53 / 1e-09 AT4G12010 420 / 1e-126 Disease resistance protein (TIR-NBS-LRR class) family (.1) Lus10015650 [exp] 52 / 2e-09 AT4G12010 346 / 3e-103 Disease resistance protein (TIR-NBS-LRR class) family (.1) Lus10010221 [exp] 51 / 4e-09 AT5G17680 369 / 4e-109 disease resistance protein (TIR-NBS-LRR class), putative (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G098600 [exp] 38 / 0.0001 AT2G20142 138 / 4e-40 Toll-Interleukin-Resistance (TIR) domain family protein (.1) Potri.019G097580 [exp] 38 / 0.0002 AT4G11170 244 / 8e-72 Disease resistance protein (TIR-NBS-LRR class) family (.1) Potri.019G098800 [exp] 37 / 0.0006 AT4G16860 255 / 3e-75 recognition of peronospora parasitica 4, Disease resistance protein (TIR-NBS-LRR class) family (.1) Potri.019G097300 [exp] 36 / 0.0006 AT4G16860 272 / 8e-81 recognition of peronospora parasitica 4, Disease resistance protein (TIR-NBS-LRR class) family (.1) Potri.019G098900 [exp] 36 / 0.0007 AT5G17680 477 / 6e-148 disease resistance protein (TIR-NBS-LRR class), putative (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0173 [flax] [poplar] STIR PF01582 [flax] [poplar] TIR TIR domain
Representative CDS sequence Show only first row Show all	>Lus10008019 pacid=23161763 polypeptide=Lus10008019 locus=Lus10008019.g ID=Lus10008019.BGIv1.0 annot-version=v1.0 ATGGCTGGTCTGTCTAATCGGCAAATCAGAACATTCATCGACGATAAGCTCGAGAAAATTGAGAGCATCGAAGAGTTGATCTCCATCCTTCAAAGTGCTC TTTCTGTGGCGATTTTCTCTGAAAAGTTTGCTCATTCAATCTGGTGCTTGGAAGAGGTAGCCACCATAGCTCGAAGGATGACAGGCATTGAAATCTACTG GTTTTCTACAAAGTGGATCCATTAG
AA sequence Show only first row Show all	>Lus10008019 pacid=23161763 polypeptide=Lus10008019 locus=Lus10008019.g ID=Lus10008019.BGIv1.0 annot-version=v1.0 MAGLSNRQIRTFIDDKLEKIESIEELISILQSALSVAIFSEKFAHSIWCLEEVATIARRMTGIEIYWFSTKWIH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G20142			Toll-Interleukin-Resistance (T...		Lus10008019 [exp]	0	1
					Lus10033890 [exp]	11.7	0.8515
AT1G76770			HSP20-like chaperones superfam...		Lus10018882 [exp]	14.1	0.8440
AT4G19510			Disease resistance protein (TI...		Lus10008209 [exp]	17.0	0.8400
					Lus10034389 [exp]	21.5	0.8370
					Lus10035810 [exp]	24.7	0.8206
					Lus10012064 [exp]	25.8	0.8096
AT1G35470			SPla/RYanodine receptor (SPRY)...		Lus10006084 [exp]	30.4	0.8269
AT1G76770			HSP20-like chaperones superfam...		Lus10028577 [exp]	30.7	0.8266
AT2G39440			unknown protein		Lus10018300 [exp]	30.9	0.8291
AT2G22795			unknown protein		Lus10028240 [exp]	32.0	0.8011

Compare expression of checked genes

Lus10008019 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.