Lus10008022 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G11600 302 / 1e-105 LSC803, PHGPX, ATGPX6 glutathione peroxidase 6 (.1)
AT4G31870 252 / 6e-86 ATGPX7 glutathione peroxidase 7 (.1)
AT2G31570 248 / 3e-85 ATGPX2 glutathione peroxidase 2 (.1)
AT1G63460 246 / 2e-84 ATGPX8 glutathione peroxidase 8 (.1)
AT2G25080 243 / 4e-82 ATGPX1 glutathione peroxidase 1 (.1)
AT2G43350 236 / 5e-80 ATGPX3 glutathione peroxidase 3 (.1.2)
AT3G63080 232 / 5e-79 ATGPX5, MEE42 maternal effect embryo arrest 42, glutathione peroxidase 5 (.1)
AT2G48150 229 / 5e-78 ATGPX4 glutathione peroxidase 4 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10008499 320 / 7e-113 AT4G11600 307 / 2e-106 glutathione peroxidase 6 (.1)
Lus10008537 316 / 3e-112 AT4G11600 299 / 1e-104 glutathione peroxidase 6 (.1)
Lus10000603 299 / 2e-105 AT4G11600 256 / 9e-88 glutathione peroxidase 6 (.1)
Lus10027021 258 / 4e-89 AT2G31570 266 / 2e-92 glutathione peroxidase 2 (.1)
Lus10008023 259 / 2e-88 AT1G63460 265 / 9e-91 glutathione peroxidase 8 (.1)
Lus10000601 255 / 3e-88 AT1G63460 256 / 2e-88 glutathione peroxidase 8 (.1)
Lus10026887 249 / 2e-84 AT4G31870 332 / 3e-116 glutathione peroxidase 7 (.1)
Lus10042418 248 / 2e-84 AT4G31870 329 / 2e-115 glutathione peroxidase 7 (.1)
Lus10029651 245 / 4e-84 AT2G48150 274 / 2e-95 glutathione peroxidase 4 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G105200 305 / 6e-108 AT4G11600 298 / 3e-104 glutathione peroxidase 6 (.1)
Potri.003G126100 306 / 3e-107 AT4G11600 307 / 9e-107 glutathione peroxidase 6 (.1)
Potri.001G105100 273 / 4e-95 AT1G63460 283 / 5e-99 glutathione peroxidase 8 (.1)
Potri.007G126600 263 / 1e-90 AT2G31570 281 / 1e-97 glutathione peroxidase 2 (.1)
Potri.006G265400 248 / 2e-84 AT2G25080 343 / 6e-121 glutathione peroxidase 1 (.1)
Potri.014G138800 231 / 8e-79 AT2G48150 271 / 1e-94 glutathione peroxidase 4 (.1)
Potri.018G017500 166 / 8e-53 AT2G25080 209 / 4e-69 glutathione peroxidase 1 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0172 Thioredoxin PF00255 GSHPx Glutathione peroxidase
Representative CDS sequence
>Lus10008022 pacid=23161769 polypeptide=Lus10008022 locus=Lus10008022.g ID=Lus10008022.BGIv1.0 annot-version=v1.0
ATGGCTACCAATTCCGACTCTCCTAAGTCCATCTACGACTTCACTGTCAAGGATGCTAGAGGGAATGATGTTGATCTCAGTATTTATAAGGGAAAAGTTC
TGTTGATTGTTAATGTTGCCTCCCAATGTGGATTGACCAATTCCAACTATACTGAGTTGACTCAACTGTACCAGAAATACAAAGATCAAGGTATGGAGAT
CTTGGCTTTTCCTTGCAATCAGTTCGGGTCTCAGGAACCAGGCAACAATGATCAAATTGTGGAGTTTGCTTGTACTCGTTTCAAGGCCGAGTTCCCCATA
TTCGATAAGGTTGATGTGAATGGAAAAGAGGCTGCTCCAATCTACAAGTACCTCAAGGCGAGCAAAGGTGGACTCTTTGGGGATGGTATCAAGTGGAACT
TCACCAAGTTCCTCGTCAACAAAGAGGGTCAGGTGGTCGATCGCTATGCTCCTACCACCTCCCCTCTCAGCATTGAGAAAGATGTGAAGAAGCTGCTTGG
GATTACATCGAAGCAATGA
AA sequence
>Lus10008022 pacid=23161769 polypeptide=Lus10008022 locus=Lus10008022.g ID=Lus10008022.BGIv1.0 annot-version=v1.0
MATNSDSPKSIYDFTVKDARGNDVDLSIYKGKVLLIVNVASQCGLTNSNYTELTQLYQKYKDQGMEILAFPCNQFGSQEPGNNDQIVEFACTRFKAEFPI
FDKVDVNGKEAAPIYKYLKASKGGLFGDGIKWNFTKFLVNKEGQVVDRYAPTTSPLSIEKDVKKLLGITSKQ

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G11600 LSC803, PHGPX, ... glutathione peroxidase 6 (.1) Lus10008022 0 1
AT3G50910 unknown protein Lus10041772 2.4 0.8069
AT1G13340 Regulator of Vps4 activity in ... Lus10034303 5.3 0.7855
AT5G64230 unknown protein Lus10010617 7.5 0.7901
AT1G76570 Chlorophyll A-B binding family... Lus10005421 7.9 0.7822
AT1G71830 ATSERK1, SERK1 somatic embryogenesis receptor... Lus10006056 9.2 0.7877
AT5G57620 MYB ATMYB36 myb domain protein 36 (.1) Lus10011606 9.5 0.8148
AT4G02920 unknown protein Lus10027996 9.6 0.8026
AT3G59080 Eukaryotic aspartyl protease f... Lus10020759 13.6 0.7831
AT2G34690 ACD11 ACCELERATED CELL DEATH 11, Gly... Lus10023267 14.4 0.7625
AT5G64230 unknown protein Lus10033177 16.7 0.7802

Lus10008022 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.