Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G56090 197 / 1e-62 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT3G25230 66 / 5e-12 ROF1, ATFKBP62 FK506 BINDING PROTEIN 62, rotamase FKBP 1 (.1.2) AT4G30480 58 / 7e-10 TPR1, AtTPR1 tetratricopeptide repeat 1, Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2), Tetratricopeptide repeat (TPR)-like superfamily protein (.3) AT1G58450 54 / 6e-09 TPR6 tetratricopeptide repeat 6, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT5G48570 55 / 1e-08 ROF2, ATFKBP65 FKBP-type peptidyl-prolyl cis-trans isomerase family protein (.1) AT1G62390 55 / 2e-08 CLMP1, Phox2 Phox2, CLUMPED CHLOROPLASTS 1, Octicosapeptide/Phox/Bem1p (PB1) domain-containing protein / tetratricopeptide repeat (TPR)-containing protein (.1) AT3G54010 48 / 3e-06 DEI1, PAS1 PASTICCINO 1, FKBP-type peptidyl-prolyl cis-trans isomerase family protein (.1.2) AT3G16760 47 / 8e-06 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) AT3G17970 47 / 8e-06 ATTOC64-III translocon at the outer membrane of chloroplasts 64-III (.1) AT5G20360 46 / 2e-05 Phox3 Phox3, Octicosapeptide/Phox/Bem1p (PB1) domain-containing protein / tetratricopeptide repeat (TPR)-containing protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10031774 [exp] 387 / 1e-136 AT1G56090 259 / 2e-86 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10031195 [exp] 372 / 6e-131 AT1G56090 260 / 8e-87 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10038216 [exp] 67 / 3e-12 AT3G25230 870 / 0.0 FK506 BINDING PROTEIN 62, rotamase FKBP 1 (.1.2) Lus10025888 [exp] 67 / 3e-12 AT3G25230 870 / 0.0 FK506 BINDING PROTEIN 62, rotamase FKBP 1 (.1.2) Lus10002338 [exp] 63 / 4e-11 AT3G25230 874 / 0.0 FK506 BINDING PROTEIN 62, rotamase FKBP 1 (.1.2) Lus10003171 [exp] 63 / 5e-11 AT3G25230 871 / 0.0 FK506 BINDING PROTEIN 62, rotamase FKBP 1 (.1.2) Lus10035117 [exp] 62 / 7e-11 AT4G30480 291 / 3e-99 tetratricopeptide repeat 1, Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2), Tetratricopeptide repeat (TPR)-like superfamily protein (.3) Lus10031983 [exp] 60 / 4e-10 AT4G30480 222 / 9e-76 tetratricopeptide repeat 1, Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2), Tetratricopeptide repeat (TPR)-like superfamily protein (.3) Lus10039592 [exp] 54 / 4e-08 AT1G62390 888 / 0.0 Phox2, CLUMPED CHLOROPLASTS 1, Octicosapeptide/Phox/Bem1p (PB1) domain-containing protein / tetratricopeptide repeat (TPR)-containing protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G097300 [exp] 237 / 2e-77 AT1G56090 260 / 2e-86 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.002G248300 [exp] 65 / 7e-12 AT3G25230 857 / 0.0 FK506 BINDING PROTEIN 62, rotamase FKBP 1 (.1.2) Potri.014G149400 [exp] 65 / 9e-12 AT5G48570 741 / 0.0 FKBP-type peptidyl-prolyl cis-trans isomerase family protein (.1) Potri.018G100700 [exp] 62 / 5e-11 AT4G30480 303 / 8e-104 tetratricopeptide repeat 1, Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2), Tetratricopeptide repeat (TPR)-like superfamily protein (.3) Potri.011G021000 [exp] 58 / 2e-09 AT1G62390 885 / 0.0 Phox2, CLUMPED CHLOROPLASTS 1, Octicosapeptide/Phox/Bem1p (PB1) domain-containing protein / tetratricopeptide repeat (TPR)-containing protein (.1) Potri.006G178900 [exp] 57 / 2e-09 AT4G30480 275 / 1e-92 tetratricopeptide repeat 1, Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2), Tetratricopeptide repeat (TPR)-like superfamily protein (.3) Potri.002G117200 [exp] 57 / 2e-09 AT5G48570 553 / 0.0 FKBP-type peptidyl-prolyl cis-trans isomerase family protein (.1) Potri.004G002900 [exp] 57 / 3e-09 AT1G62390 926 / 0.0 Phox2, CLUMPED CHLOROPLASTS 1, Octicosapeptide/Phox/Bem1p (PB1) domain-containing protein / tetratricopeptide repeat (TPR)-containing protein (.1) Potri.001G205300 [exp] 50 / 8e-07 AT5G09420 724 / 0.0 outer membrane 64, ARABIDOPSIS THALIANA TRANSLOCON AT THE OUTER MEMBRANE OF CHLOROPLASTS 64-V, translocon at the outer membrane of chloroplasts 64-V (.1) Potri.006G033400 [exp] 47 / 5e-06 AT5G48570 596 / 0.0 FKBP-type peptidyl-prolyl cis-trans isomerase family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0020 [flax] [poplar] TPR PF00515 [flax] [poplar] TPR_1 Tetratricopeptide repeat
Representative CDS sequence Show only first row Show all	>Lus10008024 pacid=23161771 polypeptide=Lus10008024 locus=Lus10008024.g ID=Lus10008024.BGIv1.0 annot-version=v1.0 ATGGAAGCGCTTTCCATGATGGCTAACACCAGCCCTCAGAAGATCTCCCTCCACAGCAACCGAGCTGCTTGCTATCTCAAGCTCCACGATTTCAAGAAGG CAGCTGAAGAGTGTACATCCGTGCTTGAGCTTGATCAAGACCACACTGGAGCGTTGATGCTGCGGGCACAGACGTTAGTTACTCTCAAAGACTATCACTC TGCGCTCTTTGATGTCAATCGGCTATTGGAGCTGGACCCTCATTCTGACGTTTACCACAATCTTGAAACTCGTTTGAGAACACAGTTGTCCCTAGCTTCA ATACCTGAGTCTGAAGCTGAACTGGAAGAAGAGGACGATAACGAATCGGAAGATGAACAAGACAGCATAGAGCAGACCAGTAAACTCGAGCCTGATGAAA GTAGTAACGAAAGTACTGTCGGTGCCGGAGAAGGTTTTGGTGAAGAACAGAGATCTGAGTCCAAGAAAAGCAGCATCACAGCCGAAGTAATTGCGCAAGC ACAGAAAAAGGCAGCCGAGCCGAGGACAAGCATTGCATCCGAAGTTATTGCACAGGCACAGAAGGCGAAGCTATCGCCCGATCAACAACAGTCGAAAGGA TGGCAGGCGATTCCGAAACCAAAGGGACACTCGACGCTGAATTACGGGCGATGGGACAGAGTCGTGGTTGATGACTCTAGCGAAGAAGATGACGGTGACG AGGATGATGATGAAGAAGAGTGTCGACCGCAGTATAGGTTCCGTGTTCGAACTGTTGGCATGCAACCTGTAAAGTGA
AA sequence Show only first row Show all	>Lus10008024 pacid=23161771 polypeptide=Lus10008024 locus=Lus10008024.g ID=Lus10008024.BGIv1.0 annot-version=v1.0 MEALSMMANTSPQKISLHSNRAACYLKLHDFKKAAEECTSVLELDQDHTGALMLRAQTLVTLKDYHSALFDVNRLLELDPHSDVYHNLETRLRTQLSLAS IPESEAELEEEDDNESEDEQDSIEQTSKLEPDESSNESTVGAGEGFGEEQRSESKKSSITAEVIAQAQKKAAEPRTSIASEVIAQAQKAKLSPDQQQSKG WQAIPKPKGHSTLNYGRWDRVVVDDSSEEDDGDEDDDEEECRPQYRFRVRTVGMQPVK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G56090			Tetratricopeptide repeat (TPR)...		Lus10008024 [exp]	0	1
AT1G68050		ADO3, FKF1	"flavin-binding, kelch repeat,...		Lus10019169 [exp]	1.0	0.8497
AT3G17740			unknown protein		Lus10031899 [exp]	3.7	0.7960
AT3G20580		COBL10	COBRA-like protein 10 precurso...		Lus10011160 [exp]	8.1	0.6818
AT4G01580	B3		AP2/B3-like transcriptional fa...		Lus10003313 [exp]	8.7	0.7473
AT4G00730	HD	AHDP, ANL2	ANTHOCYANINLESS 2, ARABIDOPSIS...		Lus10003299 [exp]	10.2	0.7552
AT1G67680			SRP72 RNA-binding domain (.1)		Lus10036924 [exp]	11.4	0.7114
AT2G47830			Cation efflux family protein (...		Lus10009817 [exp]	11.5	0.7309
AT4G32050			neurochondrin family protein (...		Lus10001536 [exp]	13.2	0.7576
AT1G60990			Glycine cleavage T-protein fam...		Lus10020818 [exp]	14.5	0.7340
AT5G54510		DFL1, GH3.6	DWARF IN LIGHT 1, Auxin-respon...		Lus10014804 [exp]	15.3	0.6309

Compare expression of checked genes

Lus10008024 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.