Lus10008031 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G12646 290 / 3e-99 PLATZ transcription factor family protein (.1)
AT3G60670 185 / 5e-58 PLATZ transcription factor family protein (.1)
AT1G31040 160 / 2e-48 PLATZ transcription factor family protein (.1)
AT1G32700 110 / 3e-29 PLATZ transcription factor family protein (.1.2)
AT1G43000 108 / 8e-29 PLATZ transcription factor family protein (.1)
AT1G21000 108 / 2e-28 PLATZ transcription factor family protein (.1.2)
AT2G01818 108 / 2e-28 PLATZ transcription factor family protein (.1)
AT4G17900 107 / 3e-28 PLATZ transcription factor family protein (.1.2)
AT1G76590 107 / 4e-28 PLATZ transcription factor family protein (.1)
AT5G46710 101 / 1e-25 PLATZ transcription factor family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10038103 440 / 4e-158 AT2G12646 289 / 1e-98 PLATZ transcription factor family protein (.1)
Lus10008814 315 / 2e-108 AT2G12646 301 / 4e-103 PLATZ transcription factor family protein (.1)
Lus10039989 313 / 2e-107 AT2G12646 292 / 3e-99 PLATZ transcription factor family protein (.1)
Lus10009283 182 / 1e-56 AT3G60670 249 / 2e-83 PLATZ transcription factor family protein (.1)
Lus10015881 181 / 3e-56 AT3G60670 251 / 4e-84 PLATZ transcription factor family protein (.1)
Lus10036226 149 / 2e-44 AT1G31040 191 / 3e-61 PLATZ transcription factor family protein (.1)
Lus10000261 122 / 2e-35 AT2G12646 40 / 5e-05 PLATZ transcription factor family protein (.1)
Lus10000482 118 / 5e-32 AT4G17900 284 / 2e-97 PLATZ transcription factor family protein (.1.2)
Lus10020337 118 / 1e-31 AT4G17900 282 / 3e-96 PLATZ transcription factor family protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G060500 323 / 2e-112 AT2G12646 321 / 1e-111 PLATZ transcription factor family protein (.1)
Potri.018G116000 320 / 4e-111 AT2G12646 318 / 2e-110 PLATZ transcription factor family protein (.1)
Potri.014G059300 171 / 1e-52 AT3G60670 238 / 6e-79 PLATZ transcription factor family protein (.1)
Potri.001G159200 166 / 1e-50 AT1G31040 294 / 3e-101 PLATZ transcription factor family protein (.1)
Potri.003G075600 166 / 4e-50 AT1G31040 306 / 1e-105 PLATZ transcription factor family protein (.1)
Potri.002G144900 164 / 1e-49 AT3G60670 250 / 7e-84 PLATZ transcription factor family protein (.1)
Potri.013G078500 114 / 9e-31 AT4G17900 312 / 1e-108 PLATZ transcription factor family protein (.1.2)
Potri.008G137300 114 / 1e-30 AT2G01818 221 / 5e-73 PLATZ transcription factor family protein (.1)
Potri.003G092800 113 / 2e-30 AT4G17900 290 / 5e-100 PLATZ transcription factor family protein (.1.2)
Potri.006G119400 110 / 1e-29 AT2G27930 212 / 3e-70 PLATZ transcription factor family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04640 PLATZ PLATZ transcription factor
Representative CDS sequence
>Lus10008031 pacid=23144296 polypeptide=Lus10008031 locus=Lus10008031.g ID=Lus10008031.BGIv1.0 annot-version=v1.0
ATGGGCAAGAAGGCGGCGACATGGTTGGAAGCGCTCCAAAATCAGAAGTTTTTCTTGACTTGTTCATACCACAAATCGGTCAAGAAGAATGTATGTTGTC
TTGATTGTTGTATTAGTATTTGTGCTCACTGCGTCCCTGCTCATCGCTCCCACAGATTGCTTCAAATTCGTCGATATGTTTACAATGACGTTGTCCAACT
CGAAGACCTCCAAAGACTTGTTGATTGTTCCAATGTTCAGGCCTACACAATCAACGGTGCAAAGGTGGTGTTCATCAAGAAAAGGCCTCAAAACAGGCAA
TTCAAAGGCTCCGGAAACTATTGCACGTCCTGTGATAGAACCCTCCAACACCCATTCATCCACTGCTCTCTTGCTTGCAAGGTGGAATTTGTGATGAAGC
ATTACAAGGATTTAAGTCTATTTGTAAAGAAATGCAAGACATTAACACTTGGACCGGACTTTTTGATCCCACAAGACATCATGAGAGACGAAAATGACAA
CATGACGACGACCAATCATTCCACAATTATGGATTATGACGAGCCAGTGAGCTGGTTGTCCGGATCTCATTCCAGCTCCTCTTCCTCCTCTTATTTATTA
GGATGTACGAACAACATGGTTGCAGCTTGTTCGAACAAAGTTGTACGAAAGAAGAGAAGCGGGTTGGTCTATTTCTGGTTGACGAATATCTATGATGATC
ATGATCATAATAGTAGTACAGTCTCCGACGAGGACATGGCCACAAGCATGAGTCGAAGGAAAGGCGTTCCTCAACGTTCACCTATGTGTTAA
AA sequence
>Lus10008031 pacid=23144296 polypeptide=Lus10008031 locus=Lus10008031.g ID=Lus10008031.BGIv1.0 annot-version=v1.0
MGKKAATWLEALQNQKFFLTCSYHKSVKKNVCCLDCCISICAHCVPAHRSHRLLQIRRYVYNDVVQLEDLQRLVDCSNVQAYTINGAKVVFIKKRPQNRQ
FKGSGNYCTSCDRTLQHPFIHCSLACKVEFVMKHYKDLSLFVKKCKTLTLGPDFLIPQDIMRDENDNMTTTNHSTIMDYDEPVSWLSGSHSSSSSSSYLL
GCTNNMVAACSNKVVRKKRSGLVYFWLTNIYDDHDHNSSTVSDEDMATSMSRRKGVPQRSPMC

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G12646 PLATZ transcription factor fam... Lus10008031 0 1
AT4G31500 SUR2, RNT1, RED... SUPERROOT 2, RUNT 1, RED ELONG... Lus10004517 2.4 0.9538
AT2G23060 Acyl-CoA N-acyltransferases (N... Lus10026088 5.7 0.9257
AT1G56290 CwfJ-like family protein (.1) Lus10021219 6.3 0.9416
AT3G15760 unknown protein Lus10030098 7.9 0.9374
AT1G64230 UBC28 ubiquitin-conjugating enzyme 2... Lus10022726 8.4 0.9282
AT1G14820 Sec14p-like phosphatidylinosit... Lus10034577 8.8 0.9343
AT5G38200 Class I glutamine amidotransfe... Lus10028493 10.6 0.9365
AT5G24550 BGLU32 beta glucosidase 32 (.1) Lus10012869 11.8 0.9230
AT1G29760 Putative adipose-regulatory pr... Lus10034735 12.0 0.9186
AT1G54100 ALDH7B4 aldehyde dehydrogenase 7B4 (.1... Lus10013155 13.4 0.9352

Lus10008031 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.