Lus10008034 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10038105 114 / 9e-34 ND /
Lus10008816 56 / 2e-11 ND /
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10008034 pacid=23144269 polypeptide=Lus10008034 locus=Lus10008034.g ID=Lus10008034.BGIv1.0 annot-version=v1.0
ATGCTGATGAGACCCTCTTTCATTGCTTATCTTCTACTTGTTTGCTTCCTCCTTCAACAAGCTCAAGGGATACGGCTCGAGAAGAGATTCCTGGATCGAG
CGGCGGCGGAGAAGGAGAAGAAGAAGAGCAAGACGATCTCACCATCATTAATAATGAAGAAAACTCGACATCCTAATGGTGGAGTAATAATAGTGGAAGA
AGAAGCAACAAAAGTTGTTTGCAAAGATGGACAACACTGTACTAGTGGTGATGAGATGAAGACAAGATCATCATCATCATCATCATCGTACCACTGGCTT
CATGAAGATTACTATGGACCTAGGAGGCACAGACCTAGGCACCATTAG
AA sequence
>Lus10008034 pacid=23144269 polypeptide=Lus10008034 locus=Lus10008034.g ID=Lus10008034.BGIv1.0 annot-version=v1.0
MLMRPSFIAYLLLVCFLLQQAQGIRLEKRFLDRAAAEKEKKKSKTISPSLIMKKTRHPNGGVIIVEEEATKVVCKDGQHCTSGDEMKTRSSSSSSSYHWL
HEDYYGPRRHRPRHH

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10008034 0 1
AT3G58190 AS2 LBD29, ASL16 ASYMMETRIC LEAVES 2-LIKE 16, l... Lus10033873 6.1 0.8538
AT1G71050 HIPP20 heavy metal associated isopren... Lus10016708 19.0 0.7758
AT4G34640 ERG9, SQS1 squalene synthase 1 (.1) Lus10028786 52.1 0.7682
Lus10039776 149.6 0.7300
AT3G26040 HXXXD-type acyl-transferase fa... Lus10025520 158.6 0.7080
AT5G05340 Peroxidase superfamily protein... Lus10006534 220.6 0.7072
AT2G41760 unknown protein Lus10007544 247.6 0.7032

Lus10008034 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.