Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G23180 115 / 4e-31 RLK4, CRK10 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1) AT4G23150 113 / 3e-30 CRK7 cysteine-rich RLK (RECEPTOR-like protein kinase) 7 (.1) AT1G61610 111 / 1e-29 S-locus lectin protein kinase family protein (.1) AT4G11530 111 / 1e-29 CRK34 cysteine-rich RLK (RECEPTOR-like protein kinase) 34 (.1) AT4G03230 110 / 3e-29 S-locus lectin protein kinase family protein (.1) AT4G11490 110 / 4e-29 CRK33 cysteine-rich RLK (RECEPTOR-like protein kinase) 33 (.1) AT3G16030 108 / 2e-28 CES101 CALLUS EXPRESSION OF RBCS 101, lectin protein kinase family protein (.1) AT4G21380 108 / 2e-28 ARK3 receptor kinase 3 (.1) AT4G23230 107 / 2e-28 CRK15 cysteine-rich RLK (RECEPTOR-like protein kinase) 15 (.1) AT4G05200 107 / 3e-28 CRK25 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10023391 [exp] 140 / 1e-39 AT1G11300 520 / 5e-168 protein serine/threonine kinases;protein kinases;ATP binding;sugar binding;kinases;carbohydrate binding (.1) Lus10038411 [exp] 126 / 2e-36 AT1G11330 308 / 1e-98 S-locus lectin protein kinase family protein (.1.2) Lus10016871 [exp] 124 / 6e-34 AT4G27290 752 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10037731 [exp] 123 / 1e-33 AT4G27290 644 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10007600 [exp] 121 / 4e-33 AT1G11300 930 / 0.0 protein serine/threonine kinases;protein kinases;ATP binding;sugar binding;kinases;carbohydrate binding (.1) Lus10018408 [exp] 121 / 6e-33 AT4G21390 936 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10006745 [exp] 120 / 8e-33 AT1G11340 774 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10016862 [exp] 120 / 1e-32 AT4G27290 702 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10016860 [exp] 120 / 1e-32 AT4G21380 743 / 0.0 receptor kinase 3 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G442200 [exp] 130 / 3e-36 AT3G16030 528 / 5e-176 CALLUS EXPRESSION OF RBCS 101, lectin protein kinase family protein (.1) Potri.001G441801 [exp] 124 / 4e-36 AT4G21390 301 / 1e-96 S-locus lectin protein kinase family protein (.1) Potri.011G125000 [exp] 130 / 5e-36 AT4G27290 790 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.001G414200 [exp] 128 / 1e-35 AT4G27290 805 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.001G441400 [exp] 125 / 1e-34 AT3G16030 523 / 1e-174 CALLUS EXPRESSION OF RBCS 101, lectin protein kinase family protein (.1) Potri.011G125050 [exp] 124 / 6e-34 AT4G27290 870 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.001G437950 [exp] 120 / 1e-33 AT4G21390 406 / 5e-135 S-locus lectin protein kinase family protein (.1) Potri.011G125100 [exp] 121 / 5e-33 AT4G27290 856 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.001G411000 [exp] 120 / 1e-32 AT4G27290 775 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.001G418100 [exp] 120 / 1e-32 AT4G27290 778 / 0.0 S-locus lectin protein kinase family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0016 [flax] [poplar] PKinase PF07714 [flax] [poplar] PK_Tyr_Ser-Thr Protein tyrosine and serine/threonine kinase
Representative CDS sequence Show only first row Show all	>Lus10008064 pacid=23170726 polypeptide=Lus10008064 locus=Lus10008064.g ID=Lus10008064.BGIv1.0 annot-version=v1.0 ATGGATTTGAAAGCCAGCAACATATTGCTGGACGAGAAGCTGAACCCAAGGATCTCAATTTTCGGAATGGCCTACATTTTCAATGGTATCGAATCAAACA CAGATGAGAGAGTCGTGGGCACACTTGGTAACATTTCGCTCGAATATGTAACAGAAGGTGTGTTTTCTGCAAAGTCAGATGTGTATAGTTTTGAAGTGTT GATACTTGAGATTGTCAGCAGCAGGAAGTGCCATGAGGGCTTTGTCGAAAAGGACATCCCACATAGCCTCGTGGGATATGCATGGCAGCTATGGAAAGAA GGGAAACCATTGAAGTTGATGGATTCAAGCTTGGGAGGAGGAGGTGGTTATAGTGAGAAATAG
AA sequence Show only first row Show all	>Lus10008064 pacid=23170726 polypeptide=Lus10008064 locus=Lus10008064.g ID=Lus10008064.BGIv1.0 annot-version=v1.0 MDLKASNILLDEKLNPRISIFGMAYIFNGIESNTDERVVGTLGNISLEYVTEGVFSAKSDVYSFEVLILEIVSSRKCHEGFVEKDIPHSLVGYAWQLWKE GKPLKLMDSSLGGGGGYSEK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G61610			S-locus lectin protein kinase ...		Lus10008064 [exp]	0	1

Compare expression of checked genes

Lus10008064 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.