Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G04400 92 / 4e-26 EMB2171 embryo defective 2171, Ribosomal protein L14p/L23e family protein (.1.2) AT2G33370 92 / 6e-26 Ribosomal protein L14p/L23e family protein (.1) AT1G04480 92 / 6e-26 Ribosomal protein L14p/L23e family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10024942 [exp] 92 / 3e-26 AT2G33370 214 / 1e-73 Ribosomal protein L14p/L23e family protein (.1) Lus10022882 [exp] 92 / 3e-26 AT3G04400 214 / 1e-73 embryo defective 2171, Ribosomal protein L14p/L23e family protein (.1.2) Lus10012464 [exp] 92 / 6e-26 AT3G04400 251 / 6e-88 embryo defective 2171, Ribosomal protein L14p/L23e family protein (.1.2) Lus10020499 [exp] 92 / 6e-26 AT1G04480 251 / 6e-88 Ribosomal protein L14p/L23e family protein (.1) Lus10023730 [exp] 92 / 8e-26 AT2G33370 278 / 3e-98 Ribosomal protein L14p/L23e family protein (.1) Lus10042695 [exp] 92 / 9e-26 AT2G33370 273 / 8e-96 Ribosomal protein L14p/L23e family protein (.1) Lus10022881 [exp] 91 / 3e-25 AT1G04480 270 / 1e-94 Ribosomal protein L14p/L23e family protein (.1) Lus10011773 [exp] 91 / 3e-25 AT2G33370 270 / 2e-94 Ribosomal protein L14p/L23e family protein (.1) Lus10024943 [exp] 91 / 3e-25 AT1G04480 270 / 2e-94 Ribosomal protein L14p/L23e family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G171200 [exp] 92 / 6e-26 AT3G04400 278 / 3e-98 embryo defective 2171, Ribosomal protein L14p/L23e family protein (.1.2) Potri.010G066400 [exp] 92 / 6e-26 AT3G04400 278 / 3e-98 embryo defective 2171, Ribosomal protein L14p/L23e family protein (.1.2) Potri.002G257500 [exp] 92 / 6e-26 AT3G04400 278 / 3e-98 embryo defective 2171, Ribosomal protein L14p/L23e family protein (.1.2) Potri.011G127250 [exp] 44 / 2e-07 AT3G04400 189 / 2e-63 embryo defective 2171, Ribosomal protein L14p/L23e family protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00238 [flax] [poplar] Ribosomal_L14 Ribosomal protein L14p/L23e
Representative CDS sequence Show only first row Show all	>Lus10008065 pacid=23170715 polypeptide=Lus10008065 locus=Lus10008065.g ID=Lus10008065.BGIv1.0 annot-version=v1.0 ATGTCCCTTGGACTTCCGCTGGCCACGACGGTCAACTGCACCGACAACACCGGGGCAAAGAACATGTACATCATTTCCGTGAAAGGAATCAAAGGTAGCC TCAACAAGCTGTCGCATGCTTGCGTTGGGGACATGGTGATGGCCACGGTGAAGACGACGTAA
AA sequence Show only first row Show all	>Lus10008065 pacid=23170715 polypeptide=Lus10008065 locus=Lus10008065.g ID=Lus10008065.BGIv1.0 annot-version=v1.0 MSLGLPLATTVNCTDNTGAKNMYIISVKGIKGSLNKLSHACVGDMVMATVKTT

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G04480			Ribosomal protein L14p/L23e fa...		Lus10008065 [exp]	0	1
AT4G24190		AtHsp90-7, HSP9...	SHEPHERD, HEAT SHOCK PROTEIN 9...		Lus10035109 [exp]	4.6	0.8701
AT5G14930		GENE101, SAG101	senescence-associated gene 101...		Lus10004841 [exp]	4.7	0.8960
AT5G10530			Concanavalin A-like lectin pro...		Lus10020447 [exp]	5.8	0.8895
AT3G44670			Disease resistance protein (TI...		Lus10015465 [exp]	7.2	0.8177
AT4G05440		EDA35	embryo sac development arrest ...		Lus10000812 [exp]	7.4	0.8531
AT2G34480			Ribosomal protein L18ae/LX fam...		Lus10023453 [exp]	8.9	0.8362
AT2G36960	MYB	TKI1	TSL-kinase interacting protein...		Lus10010230 [exp]	9.5	0.8505
AT1G22620		ATSAC1	suppressor of actin 1, Phospho...		Lus10016941 [exp]	10.4	0.8557
AT4G37340		CYP81D3	"cytochrome P450, family 81, s...		Lus10024973 [exp]	11.7	0.8088
AT1G61100			disease resistance protein (TI...		Lus10025112 [exp]	14.7	0.8352

Compare expression of checked genes

Lus10008065 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.