Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G61700 129 / 4e-41 RNA polymerases N / 8 kDa subunit (.1) AT1G11475 125 / 2e-39 NRPE10, NRPD10, NRPB10 RNA polymerases N / 8 kDa subunit (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10013128 [exp] 133 / 4e-42 AT1G61700 129 / 1e-40 RNA polymerases N / 8 kDa subunit (.1) Lus10025907 [exp] 109 / 3e-33 AT1G61700 105 / 5e-32 RNA polymerases N / 8 kDa subunit (.1) Lus10038195 [exp] 109 / 5e-33 AT1G61700 105 / 6e-32 RNA polymerases N / 8 kDa subunit (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G102900 [exp] 131 / 6e-42 AT1G61700 138 / 8e-45 RNA polymerases N / 8 kDa subunit (.1) Potri.006G136300 [exp] 131 / 6e-42 AT1G61700 138 / 8e-45 RNA polymerases N / 8 kDa subunit (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01194 [flax] [poplar] RNA_pol_N RNA polymerases N / 8 kDa subunit
Representative CDS sequence Show only first row Show all	>Lus10008095 pacid=23169742 polypeptide=Lus10008095 locus=Lus10008095.g ID=Lus10008095.BGIv1.0 annot-version=v1.0 ATGATTATACCAGTTCGTTGCTTCACTTGCGGCAAGGTGATTGGCCACAAATGGGATACTTACCTTGATCTTCTTCAAGCTGATTACACTGAAGGTGATG CTCTTGATGCACTGGGGTTGGTCCGTTATTGCTGCAGAAGAATGCTCATGACCCATGTCGATCTCATCGAGAAACTCCTAAACTACAATAGTATGTCTCT CTCTGTGTCTTCTGTTGAATGCGTGGTGTGTTTACCTGCGTATCCATTGCTCACTCTACTCTTGCTATAG
AA sequence Show only first row Show all	>Lus10008095 pacid=23169742 polypeptide=Lus10008095 locus=Lus10008095.g ID=Lus10008095.BGIv1.0 annot-version=v1.0 MIIPVRCFTCGKVIGHKWDTYLDLLQADYTEGDALDALGLVRYCCRRMLMTHVDLIEKLLNYNSMSLSVSSVECVVCLPAYPLLTLLLL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G61700			RNA polymerases N / 8 kDa subu...		Lus10008095 [exp]	0	1
AT3G01435			Expressed protein (.1)		Lus10003331 [exp]	4.5	0.8409
AT2G35736			unknown protein		Lus10028935 [exp]	4.6	0.8658
AT3G11500			Small nuclear ribonucleoprotei...		Lus10017019 [exp]	5.2	0.8734
AT5G12080		ATMSL10, MSL10	mechanosensitive channel of sm...		Lus10011954 [exp]	6.0	0.8316
AT3G25210			Tetratricopeptide repeat (TPR)...		Lus10038215 [exp]	6.3	0.8646
AT2G01640			unknown protein		Lus10002816 [exp]	7.1	0.8573
AT5G56670			Ribosomal protein S30 family p...		Lus10017473 [exp]	8.9	0.8659
AT4G21800		QQT2	quatre-quart2, P-loop containi...		Lus10019602 [exp]	9.2	0.8546
AT1G10865			unknown protein		Lus10032774 [exp]	10.3	0.7841
AT3G19650			cyclin-related (.1)		Lus10002122 [exp]	11.2	0.8197

Compare expression of checked genes

Lus10008095 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.