Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G54120 55 / 5e-11 unknown protein AT3G14060 39 / 6e-05 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10013152 [exp] 144 / 3e-46 AT1G54120 84 / 2e-21 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G167600 [exp] 67 / 1e-15 AT1G54120 59 / 4e-12 unknown protein Potri.003G067200 [exp] 61 / 2e-13 AT3G14060 66 / 1e-14 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10008114 pacid=23169782 polypeptide=Lus10008114 locus=Lus10008114.g ID=Lus10008114.BGIv1.0 annot-version=v1.0 ATGCTCAGAAGGGTGCGGCTCCGGTGGCTGAAACTCCGGTACGGCCAGTTCTTCAAGAAGCTGAAGGAATACTACAAGGGTTTGGTTAAGGACATCATCG ACGCCGGAGCCACCATCGAAGCTTACCAACAGAGGATGTTGATGGAGACGAGTCTGGCTGTTCCCATGGGCGTTTCTTTCTCTACTTTCCCCATGGCGGC CGCCGGCCGATCTGATCTCTACCACCTTCCTCGCTACGGCGGCGGTCTCTCCTTCTGA
AA sequence Show only first row Show all	>Lus10008114 pacid=23169782 polypeptide=Lus10008114 locus=Lus10008114.g ID=Lus10008114.BGIv1.0 annot-version=v1.0 MLRRVRLRWLKLRYGQFFKKLKEYYKGLVKDIIDAGATIEAYQQRMLMETSLAVPMGVSFSTFPMAAAGRSDLYHLPRYGGGLSF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G54120			unknown protein		Lus10008114 [exp]	0	1
AT1G52340		SIS4, SDR1, ISI...	SHORT-CHAIN DEHYDROGENASE REDU...		Lus10029371 [exp]	3.7	0.8647
AT1G16760			Protein kinase protein with ad...		Lus10008609 [exp]	6.7	0.8327
AT2G24370			Protein kinase protein with ad...		Lus10008610 [exp]	8.1	0.8138
AT2G32300		UCC1	uclacyanin 1 (.1)		Lus10027143 [exp]	8.9	0.8562
AT2G44840	AP2_ERF	ATERF13, EREBP	ethylene-responsive element bi...		Lus10029331 [exp]	10.7	0.8495
AT2G28670		ESB1	ENHANCED SUBERIN 1, Disease re...		Lus10006317 [exp]	11.2	0.8673
AT1G19230			Riboflavin synthase-like super...		Lus10034890 [exp]	13.2	0.8508
					Lus10033509 [exp]	14.4	0.8574
AT1G22900			Disease resistance-responsive ...		Lus10025804 [exp]	16.0	0.8446
AT4G39660		AGT2	alanine:glyoxylate aminotransf...		Lus10004480 [exp]	21.9	0.8420

Compare expression of checked genes

Lus10008114 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.