Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G01370 150 / 3e-47 CENH3, HTR12 CENTROMERIC HISTONE H3, Histone superfamily protein (.1.2) AT5G10980 124 / 8e-38 Histone superfamily protein (.1) AT4G40030 124 / 8e-38 Histone superfamily protein (.1.2.3) AT4G40040 124 / 8e-38 Histone superfamily protein (.1.2) AT1G09200 124 / 2e-37 Histone superfamily protein (.1) AT3G27360 124 / 2e-37 Histone superfamily protein (.1) AT5G10390 124 / 2e-37 Histone superfamily protein (.1) AT5G10400 124 / 2e-37 Histone superfamily protein (.1) AT5G65360 124 / 2e-37 Histone superfamily protein (.1) AT1G19890 122 / 6e-37 ATMGH3, MGH3 male-gamete-specific histone H3 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10031822 [exp] 123 / 3e-37 AT5G10400 271 / 1e-95 Histone superfamily protein (.1) Lus10005271 [exp] 123 / 3e-37 AT1G09200 271 / 1e-95 Histone superfamily protein (.1) Lus10005270 [exp] 123 / 3e-37 AT1G09200 271 / 1e-95 Histone superfamily protein (.1) Lus10031250 [exp] 123 / 3e-37 AT1G09200 271 / 1e-95 Histone superfamily protein (.1) Lus10025439 [exp] 123 / 3e-37 AT5G65360 271 / 1e-95 Histone superfamily protein (.1) Lus10012744 [exp] 122 / 6e-37 AT5G65360 271 / 2e-95 Histone superfamily protein (.1) Lus10031821 [exp] 124 / 7e-37 AT3G27360 273 / 3e-95 Histone superfamily protein (.1) Lus10031252 [exp] 122 / 1e-36 AT3G27360 268 / 2e-94 Histone superfamily protein (.1) Lus10012757 [exp] 120 / 3e-36 AT4G40030 229 / 3e-79 Histone superfamily protein (.1.2.3)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G096400 [exp] 172 / 2e-56 AT1G01370 158 / 5e-50 CENTROMERIC HISTONE H3, Histone superfamily protein (.1.2) Potri.007G096700 [exp] 124 / 8e-38 AT5G10980 274 / 1e-96 Histone superfamily protein (.1) Potri.007G014300 [exp] 124 / 8e-38 AT5G10980 274 / 1e-96 Histone superfamily protein (.1) Potri.002G026800 [exp] 124 / 8e-38 AT5G10980 274 / 1e-96 Histone superfamily protein (.1) Potri.002G100200 [exp] 124 / 8e-38 AT5G10980 274 / 1e-96 Histone superfamily protein (.1) Potri.005G235700 [exp] 124 / 8e-38 AT5G10980 274 / 1e-96 Histone superfamily protein (.1) Potri.005G072300 [exp] 124 / 8e-38 AT5G10980 274 / 1e-96 Histone superfamily protein (.1) Potri.014G096900 [exp] 124 / 2e-37 AT5G65360 235 / 3e-81 Histone superfamily protein (.1) Potri.002G028800 [exp] 124 / 2e-37 AT5G65360 235 / 3e-81 Histone superfamily protein (.1) Potri.003G210100 [exp] 124 / 2e-37 AT5G65360 235 / 3e-81 Histone superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0012 [flax] [poplar] Histone PF00125 [flax] [poplar] Histone Core histone H2A/H2B/H3/H4
Representative CDS sequence Show only first row Show all	>Lus10008119 pacid=23169764 polypeptide=Lus10008119 locus=Lus10008119.g ID=Lus10008119.BGIv1.0 annot-version=v1.0 ATGGCCAGAGTCAAGCATTCAGCTGTCAAGAGTCGGCCTCCCAAGAAGAAATCTGCTGAAACACAAAAGAAGAAGTATCGCTTCAAGCCTGGCACTCGAG CTCTACAAGAAATCCGTCACTACCAGAAGAGTACTGGTTTCTTGATCCCTGTTGCTCCCTTTATTCGACTGGTAAGAATGATCACTCAGGAGTTTAGCAA GGAAGTTACCCGCTATCAAGCTGAAGCTCTAGTCGCTATTCAAGAGGCAGCAGAGGACTTCTTGGTCCATTTGTTTGAAGACGGAATGCTCTGTGCAATT CATGCGAAACGCGTCACACTGATGAAGAAGGATATGGAGCTGGCTCGTCGAATCGGAGGGCAAGGGAGACGATGGTGA
AA sequence Show only first row Show all	>Lus10008119 pacid=23169764 polypeptide=Lus10008119 locus=Lus10008119.g ID=Lus10008119.BGIv1.0 annot-version=v1.0 MARVKHSAVKSRPPKKKSAETQKKKYRFKPGTRALQEIRHYQKSTGFLIPVAPFIRLVRMITQEFSKEVTRYQAEALVAIQEAAEDFLVHLFEDGMLCAI HAKRVTLMKKDMELARRIGGQGRRW

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G01370		CENH3, HTR12	CENTROMERIC HISTONE H3, Histon...		Lus10008119 [exp]	0	1
AT1G77580			Plant protein of unknown funct...		Lus10029679 [exp]	2.6	0.9177
AT1G67180			zinc finger (C3HC4-type RING f...		Lus10034088 [exp]	4.6	0.9063
AT1G04030			unknown protein		Lus10029611 [exp]	4.9	0.9077
AT3G53730			Histone superfamily protein (....		Lus10005898 [exp]	5.3	0.9040
AT4G37210			Tetratricopeptide repeat (TPR)...		Lus10000740 [exp]	6.0	0.8733
AT3G53730			Histone superfamily protein (....		Lus10040849 [exp]	6.7	0.8976
AT1G67230		CRWN1, LINC1	CROWDED NUCLEI 1, little nucle...		Lus10034076 [exp]	8.5	0.8667
AT5G35520		MIS12, ATMIS12	MIS12 HOMOLOGUE, ARABIDOPSIS M...		Lus10009652 [exp]	8.8	0.8920
AT4G28950		ATRAC7, ARAC7, ...	Arabidopsis RAC-like 7, RHO-re...		Lus10023660 [exp]	11.5	0.8705
AT1G53590		NTMCTYPE6.1 ,NT...	Calcium-dependent lipid-bindin...		Lus10026192 [exp]	12.2	0.8298

Compare expression of checked genes

Lus10008119 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.