Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G14170 85 / 1e-20 Plant protein of unknown function (DUF936) (.1) AT1G08760 50 / 3e-08 Plant protein of unknown function (DUF936) (.1) AT4G13370 45 / 8e-07 Plant protein of unknown function (DUF936) (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10013177 [exp] 177 / 8e-55 AT3G14170 459 / 9e-158 Plant protein of unknown function (DUF936) (.1) Lus10019398 [exp] 47 / 2e-07 AT4G13370 646 / 0.0 Plant protein of unknown function (DUF936) (.1) Lus10026806 [exp] 47 / 3e-07 AT1G08760 732 / 0.0 Plant protein of unknown function (DUF936) (.1) Lus10043255 [exp] 46 / 8e-07 AT4G13370 652 / 0.0 Plant protein of unknown function (DUF936) (.1) Lus10036076 [exp] 43 / 7e-06 AT1G08760 731 / 0.0 Plant protein of unknown function (DUF936) (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G070200 [exp] 117 / 2e-32 AT3G14170 458 / 2e-157 Plant protein of unknown function (DUF936) (.1) Potri.017G026200 [exp] 60 / 6e-12 AT1G08760 719 / 0.0 Plant protein of unknown function (DUF936) (.1) Potri.007G131600 [exp] 59 / 1e-11 AT1G08760 674 / 0.0 Plant protein of unknown function (DUF936) (.1) Potri.018G072500 [exp] 49 / 4e-08 AT4G13370 719 / 0.0 Plant protein of unknown function (DUF936) (.1) Potri.009G024800 [exp] 39 / 0.0002 AT2G31920 293 / 1e-91 Plant protein of unknown function (DUF936) (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF06075 [flax] [poplar] DUF936 Plant protein of unknown function (DUF936)
Representative CDS sequence Show only first row Show all	>Lus10008137 pacid=23169780 polypeptide=Lus10008137 locus=Lus10008137.g ID=Lus10008137.BGIv1.0 annot-version=v1.0 ATGGATGAAGCATTAGACTCTGGATTCCGGGTTCCGGTCCAAGAAAGGAAAGGGAAAGGTAGCGGAAGAGGAAGATTAATGGAAGCTGAGAACAACCAGA TTGCTGTCACTTTATCACAACTCAAGCATGCAAATGACTGGTTAGACAAACTAAGAAACAACCTGAATGATGAAATCAATGCTCCGCTCATCGAGAATAT TGACTGTTTGAAGAAAAAGGTATATGCTTGCCTGCTTGCTCATGTAGATTCTGCTGCGTTGGCCTTGGAGAACCAAGCAGATCGATGCTGA
AA sequence Show only first row Show all	>Lus10008137 pacid=23169780 polypeptide=Lus10008137 locus=Lus10008137.g ID=Lus10008137.BGIv1.0 annot-version=v1.0 MDEALDSGFRVPVQERKGKGSGRGRLMEAENNQIAVTLSQLKHANDWLDKLRNNLNDEINAPLIENIDCLKKKVYACLLAHVDSAALALENQADRC

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G14170			Plant protein of unknown funct...		Lus10008137 [exp]	0	1
AT2G26800			Aldolase superfamily protein (...		Lus10036056 [exp]	2.4	0.8741
AT3G27960			Tetratricopeptide repeat (TPR)...		Lus10008786 [exp]	4.5	0.8943
AT3G07570			Cytochrome b561/ferric reducta...		Lus10001180 [exp]	6.6	0.8497
AT1G75410	HD	BLH3	BEL1-like homeodomain 3 (.1.2)		Lus10033192 [exp]	7.9	0.8547
AT3G29185			Domain of unknown function (DU...		Lus10015378 [exp]	9.9	0.8654
AT4G33950		ATOST1, P44, SR...	SNF1-RELATED PROTEIN KINASE 2....		Lus10004748 [exp]	11.5	0.8483
AT5G01180		ATPTR5	ARABIDOPSIS THALIANA PEPTIDE T...		Lus10018207 [exp]	14.7	0.8343
AT1G75410	HD	BLH3	BEL1-like homeodomain 3 (.1.2)		Lus10010633 [exp]	15.0	0.8390
AT1G06550			ATP-dependent caseinolytic (Cl...		Lus10007334 [exp]	16.1	0.8187
AT1G06550			ATP-dependent caseinolytic (Cl...		Lus10020758 [exp]	18.0	0.8549

Compare expression of checked genes

Lus10008137 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.