Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G54070 56 / 4e-11 Dormancy/auxin associated family protein (.1) AT1G56220 45 / 4e-07 Dormancy/auxin associated family protein (.1.2.3.4) AT1G28330 40 / 4e-05 DYL1, DRM1 DORMANCY-ASSOCIATED PROTEIN 1, dormancy-associated protein-like 1 (.1.2.3.4.5) AT2G33830 36 / 0.001 Dormancy/auxin associated family protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10013180 [exp] 96 / 8e-26 AT1G54070 78 / 5e-19 Dormancy/auxin associated family protein (.1) Lus10020661 [exp] 49 / 2e-08 AT1G56220 126 / 2e-38 Dormancy/auxin associated family protein (.1.2.3.4) Lus10029881 [exp] 49 / 2e-07 AT5G27830 245 / 9e-80 unknown protein Lus10015193 [exp] 44 / 3e-06 AT1G56220 134 / 3e-41 Dormancy/auxin associated family protein (.1.2.3.4) Lus10031488 [exp] 44 / 3e-06 AT1G56220 136 / 3e-42 Dormancy/auxin associated family protein (.1.2.3.4) Lus10013996 [exp] 39 / 7e-05 AT1G28330 74 / 2e-18 DORMANCY-ASSOCIATED PROTEIN 1, dormancy-associated protein-like 1 (.1.2.3.4.5) Lus10013997 [exp] 39 / 8e-05 AT1G28330 119 / 4e-36 DORMANCY-ASSOCIATED PROTEIN 1, dormancy-associated protein-like 1 (.1.2.3.4.5) Lus10015418 [exp] 39 / 8e-05 AT1G28330 120 / 7e-37 DORMANCY-ASSOCIATED PROTEIN 1, dormancy-associated protein-like 1 (.1.2.3.4.5) Lus10025446 [exp] 37 / 0.0007 AT2G33830 82 / 4e-22 Dormancy/auxin associated family protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G070500 [exp] 59 / 4e-12 AT1G54070 90 / 6e-24 Dormancy/auxin associated family protein (.1) Potri.001G164800 [exp] 57 / 2e-11 AT1G54070 67 / 3e-15 Dormancy/auxin associated family protein (.1) Potri.005G024250 [exp] 44 / 2e-06 AT1G56220 86 / 2e-23 Dormancy/auxin associated family protein (.1.2.3.4) Potri.013G014900 [exp] 42 / 1e-05 AT1G56220 97 / 7e-27 Dormancy/auxin associated family protein (.1.2.3.4) Potri.004G047100 [exp] 41 / 2e-05 AT1G28330 122 / 7e-37 DORMANCY-ASSOCIATED PROTEIN 1, dormancy-associated protein-like 1 (.1.2.3.4.5)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF05564 [flax] [poplar] Auxin_repressed Dormancy/auxin associated protein
Representative CDS sequence Show only first row Show all	>Lus10008142 pacid=23169771 polypeptide=Lus10008142 locus=Lus10008142.g ID=Lus10008142.BGIv1.0 annot-version=v1.0 ATGGGGTTTTTGCATAAATTATGGGACGAAACGTTAGCCGGCCCCACACCAGAAGCCGGCCTGGGAAAGCTACGAAAGTATGAATCCTTCTCCTCCTCCC CCACCGCCTTATTAACTACTTCTCCGTTGCAGCCGTCGGCGATAACAATTATAGGTAACCGAGGTGCTCCCCTAACGATCACAAGAACTATTACAATCGC GAGGAACAATAAGAGAATTCGTTGCAATTCGACTGATTGCACGTATTCTCCTAATTGTAATTCTCCAATGGCGATTGATTTCCCGACACCATCTACTCCT GGTACCCCTTCAGCTTCTGATCAAACACCTCGTGGGTGGGGAAGGAGGAAGAATGTATAA
AA sequence Show only first row Show all	>Lus10008142 pacid=23169771 polypeptide=Lus10008142 locus=Lus10008142.g ID=Lus10008142.BGIv1.0 annot-version=v1.0 MGFLHKLWDETLAGPTPEAGLGKLRKYESFSSSPTALLTTSPLQPSAITIIGNRGAPLTITRTITIARNNKRIRCNSTDCTYSPNCNSPMAIDFPTPSTP GTPSASDQTPRGWGRRKNV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G54070			Dormancy/auxin associated fami...		Lus10008142 [exp]	0	1

Compare expression of checked genes

Lus10008142 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.