Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10007197 [exp] 132 / 5e-42 ND / Lus10015702 [exp] 133 / 4e-41 ND 38 / 0.004 Lus10010402 [exp] 127 / 9e-39 ND / Lus10000686 [exp] 125 / 3e-38 AT1G17930 87 / 3e-20 Aminotransferase-like, plant mobile domain family protein (.1) Lus10017181 [exp] 122 / 2e-37 ND / Lus10032804 [exp] 122 / 7e-37 ND / Lus10012087 [exp] 118 / 1e-34 AT1G17930 57 / 4e-09 Aminotransferase-like, plant mobile domain family protein (.1) Lus10024265 [exp] 118 / 2e-34 AT1G17930 59 / 9e-10 Aminotransferase-like, plant mobile domain family protein (.1) Lus10003272 [exp] 115 / 6e-34 ND 39 / 0.002
Poplar homologues Show only best Show top 10	No hit found
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF10536 [flax] [poplar] PMD Plant mobile domain
Representative CDS sequence Show only first row Show all	>Lus10008145 pacid=23163382 polypeptide=Lus10008145 locus=Lus10008145.g ID=Lus10008145.BGIv1.0 annot-version=v1.0 ATGGATTCCCGTGATGTTTGTTGGCTTCCTTTTGGACCTCATCCCGACATTGAGGTCCCCGCTACGACCTACCGTGGTCTCCTACGTTGCGCCGATGTTG GGGAGTTCTACGATTCTTATCGTGTGCTCCGACAGTTTGGCTTCACACAGGTCGTCCCCCCCTCGATCCCTGTGCCGCTACGGGCCATTGGCCCAAATCT ATCCGGACATATGCCGTCTACGGGGTATCGGAGCCAGAGAGAGAGTTGA
AA sequence Show only first row Show all	>Lus10008145 pacid=23163382 polypeptide=Lus10008145 locus=Lus10008145.g ID=Lus10008145.BGIv1.0 annot-version=v1.0 MDSRDVCWLPFGPHPDIEVPATTYRGLLRCADVGEFYDSYRVLRQFGFTQVVPPSIPVPLRAIGPNLSGHMPSTGYRSQRES

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10008145 [exp]	0	1
AT1G35467		RALFL5	RALF-like 5 (.1)		Lus10006213 [exp]	10.8	0.5043
AT3G23730		XTH16	xyloglucan endotransglucosylas...		Lus10000678 [exp]	15.1	0.5328
					Lus10000085 [exp]	24.1	0.4847
AT3G14250			RING/U-box superfamily protein...		Lus10022064 [exp]	26.7	0.4659
					Lus10037474 [exp]	33.0	0.4810
AT3G03480		CHAT	acetyl CoA:(Z)-3-hexen-1-ol ac...		Lus10020334 [exp]	41.5	0.4459
AT1G26930			Galactose oxidase/kelch repeat...		Lus10023608 [exp]	45.5	0.4828
AT2G39550		GGB, ATGGT-IB, ...	GERANYLGERANYLTRANSFERASE-I BE...		Lus10017310 [exp]	50.7	0.4584
AT3G20580		COBL10	COBRA-like protein 10 precurso...		Lus10043065 [exp]	52.7	0.4219
AT3G13790		ATCWINV1, ATBFR...	ARABIDOPSIS THALIANA CELL WALL...		Lus10022696 [exp]	61.5	0.4319

Compare expression of checked genes

Lus10008145 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.