Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G04650 57 / 8e-11 RNA-directed DNA polymerase (reverse transcriptase)-related family protein (.1) AT1G43730 56 / 3e-10 RNA-directed DNA polymerase (reverse transcriptase)-related family protein (.1) AT5G18880 53 / 3e-09 RNA-directed DNA polymerase (reverse transcriptase)-related family protein (.1) AT5G16486 52 / 4e-09 RNA-directed DNA polymerase (reverse transcriptase)-related family protein (.1) AT3G24255 52 / 7e-09 RNA-directed DNA polymerase (reverse transcriptase)-related family protein (.1), RNA-directed DNA polymerase (reverse transcriptase)-related family protein (.2) AT2G02520 51 / 1e-08 RNA-directed DNA polymerase (reverse transcriptase)-related family protein (.1) AT1G60720 50 / 2e-08 RNA-directed DNA polymerase (reverse transcriptase)-related family protein (.1) AT1G33710 49 / 5e-08 RNA-directed DNA polymerase (reverse transcriptase)-related family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018808 [exp] 74 / 5e-18 AT5G18880 57 / 2e-10 RNA-directed DNA polymerase (reverse transcriptase)-related family protein (.1) Lus10026142 [exp] 67 / 5e-14 AT3G11440 370 / 5e-115 myb domain protein 65 (.1) Lus10008685 [exp] 59 / 5e-11 AT3G11440 357 / 3e-115 myb domain protein 65 (.1) Lus10040060 [exp] 43 / 4e-06 AT5G18880 40 / 1e-04 RNA-directed DNA polymerase (reverse transcriptase)-related family protein (.1) Lus10001530 [exp] 0 / 1 AT5G23110 5981 / 0.0 Zinc finger, C3HC4 type (RING finger) family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G000150 [exp] 47 / 3e-07 AT1G43730 107 / 4e-27 RNA-directed DNA polymerase (reverse transcriptase)-related family protein (.1) Potri.010G000101 [exp] 45 / 2e-06 AT3G24255 193 / 1e-53 RNA-directed DNA polymerase (reverse transcriptase)-related family protein (.1), RNA-directed DNA polymerase (reverse transcriptase)-related family protein (.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10008147 pacid=23163379 polypeptide=Lus10008147 locus=Lus10008147.g ID=Lus10008147.BGIv1.0 annot-version=v1.0 ATGTCGACTACACCCCTTGTTGTGAAGTTCATTTCTTACTCTTCTAATGGGAAGTTGCTTTGGAATGGAAATACATTGGAGAAGTTCAAAGTTTCAGAAG TTCGGAACACCATTCGTCCCTCTGCCTCGATTGTGAATTGGTGTGATATGGATTTGAAACAGTCGAGCATCCCTATGCATTCGTTTATTACTTGGCTTGC TATTAAAGGGAGACTAATTACCAAGGATCGAATGACTTCTTGGGATCTTTCTATTGACATTACTTGTTTATTGTGTGATGAGGGTGTGGATGCCATTGAG ATGCTCGTTTTTTCGGTCTGTTTGGCGTTTCTATTCTGGAAAAGATAG
AA sequence Show only first row Show all	>Lus10008147 pacid=23163379 polypeptide=Lus10008147 locus=Lus10008147.g ID=Lus10008147.BGIv1.0 annot-version=v1.0 MSTTPLVVKFISYSSNGKLLWNGNTLEKFKVSEVRNTIRPSASIVNWCDMDLKQSSIPMHSFITWLAIKGRLITKDRMTSWDLSIDITCLLCDEGVDAIE MLVFSVCLAFLFWKR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G04650			RNA-directed DNA polymerase (r...		Lus10008147 [exp]	0	1
					Lus10033730 [exp]	6.4	0.7298
AT5G43370		PHT1;2, APT1, P...	ARABIDOPSIS PHOSPHATE TRANSPOR...		Lus10027631 [exp]	7.9	0.6971
AT1G63060			unknown protein		Lus10001796 [exp]	12.1	0.6820
AT1G63060			unknown protein		Lus10002567 [exp]	13.0	0.6820
AT4G05120		FUR1, ENT3, FLU...	FUDR RESISTANT 1, EQUILIBRATIV...		Lus10018523 [exp]	13.7	0.6924
AT3G22060			Receptor-like protein kinase-r...		Lus10022286 [exp]	16.7	0.6590
AT4G04320			malonyl-CoA decarboxylase fami...		Lus10015550 [exp]	19.9	0.7150
AT3G01680		SEOR1, SEOb	Sieve-Element-Occlusion-Relate...		Lus10000546 [exp]	29.4	0.6896
AT1G25270			nodulin MtN21 /EamA-like trans...		Lus10012691 [exp]	31.3	0.6435
AT1G17930			Aminotransferase-like, plant m...		Lus10004818 [exp]	36.4	0.6187

Compare expression of checked genes

Lus10008147 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.