Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10010397 [exp] 215 / 9e-74 ND / Lus10017027 [exp] 202 / 3e-64 AT1G57790 286 / 6e-93 F-box family protein (.1) Lus10008850 [exp] 187 / 2e-62 AT1G48120 39 / 8e-04 hydrolases;protein serine/threonine phosphatases (.1) Lus10014871 [exp] 182 / 7e-61 ND / Lus10016306 [exp] 184 / 3e-60 ND / Lus10003026 [exp] 183 / 3e-59 AT2G25010 45 / 4e-05 Aminotransferase-like, plant mobile domain family protein (.1) Lus10006285 [exp] 178 / 3e-59 ND / Lus10015869 [exp] 175 / 3e-57 AT1G48120 44 / 3e-05 hydrolases;protein serine/threonine phosphatases (.1) Lus10003952 [exp] 166 / 9e-54 ND /
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10008153 pacid=23163377 polypeptide=Lus10008153 locus=Lus10008153.g ID=Lus10008153.BGIv1.0 annot-version=v1.0 ATGCCAGAGGTTGCTGTCAGGCATGCTGATGGCATACTTTATGATGTGCACCACACGAGGTGCAATTTCTGCCATCCCGGTGCTTTGGCATACTTTCCAA AGATTAGCATACCGTGTGTACCTCATGCACCTGGCGGTAATGTGTTCCCCGATTACCTGGCCTGGTATCTCGACCGCACACATCCATACATCACCCCGTC ACTCACCACAGATGAGCCCCCGGTTTCTGATTACCCGCCACAGCCTATTTCTGACCGCATTGTCCACGGATTGGCGCCCCTTTGGGAAGCCGACACTTTA GAGGCTTTCGTTGACAGAGGTGCAGAGTACTTCAAGTTGGTTCAGTCCATGGAGGGGTTGTTTTGA
AA sequence Show only first row Show all	>Lus10008153 pacid=23163377 polypeptide=Lus10008153 locus=Lus10008153.g ID=Lus10008153.BGIv1.0 annot-version=v1.0 MPEVAVRHADGILYDVHHTRCNFCHPGALAYFPKISIPCVPHAPGGNVFPDYLAWYLDRTHPYITPSLTTDEPPVSDYPPQPISDRIVHGLAPLWEADTL EAFVDRGAEYFKLVQSMEGLF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10008153 [exp]	0	1
AT5G17600			RING/U-box superfamily protein...		Lus10008458 [exp]	3.5	0.9800
AT4G10850		SWEET7, AtSWEET...	Nodulin MtN3 family protein (....		Lus10023047 [exp]	4.9	0.9800
AT1G70780			unknown protein		Lus10009131 [exp]	5.2	0.8400
AT5G12060			Plant self-incompatibility pro...		Lus10023195 [exp]	6.0	0.9800
AT4G05030			Copper transport protein famil...		Lus10025179 [exp]	6.8	0.8600
AT4G35610	C2H2ZnF		zinc finger (C2H2 type) family...		Lus10035994 [exp]	6.9	0.9785
AT5G07480		KUOX1	KAR-UP oxidoreductase 1 (.1)		Lus10043000 [exp]	7.7	0.9784
AT3G08710		TRXH9, ATH9	THIOREDOXIN TYPE H 9, thioredo...		Lus10030505 [exp]	8.5	0.9776
AT3G62770		ATATG18A	autophagy 18a, Transducin/WD40...		Lus10023022 [exp]	9.2	0.9762
AT1G76810			eukaryotic translation initiat...		Lus10023474 [exp]	9.8	0.9759

Compare expression of checked genes

Lus10008153 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.