Lus10008155 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10008155 pacid=23163387 polypeptide=Lus10008155 locus=Lus10008155.g ID=Lus10008155.BGIv1.0 annot-version=v1.0
ATGGCACAATTACTTCTGATTCAGCTGAGGTCTTCCTTGCTGAATCAAGGATCTCTGACATCCAAGCTGCTGAAACTCCTCAAACTAATGGGTTTCAGTT
GCTATGTGTCGAAATATTTTTCAAATAGCTATCCTGCTTTACCTCACTCAAAGTTACTTCTTGCTTGTAAATTCATAGATATGCAGGATGTTTCGCTTCT
GGATAAGAAGAGGCATCGCCTTGATGATATTGATCTCGAGGATTCTTCTTCCTCTCAAAAGAAGGCTCGTCTACTTCAGCCAGTTACAGAGGCGGACTTC
CTAGCCAGAGCTATGGATTTGGAGCTCCCCCAGATGATATGCTCGATGGTGATCCGGACATGA
AA sequence
>Lus10008155 pacid=23163387 polypeptide=Lus10008155 locus=Lus10008155.g ID=Lus10008155.BGIv1.0 annot-version=v1.0
MAQLLLIQLRSSLLNQGSLTSKLLKLLKLMGFSCYVSKYFSNSYPALPHSKLLLACKFIDMQDVSLLDKKRHRLDDIDLEDSSSSQKKARLLQPVTEADF
LARAMDLELPQMICSMVIRT

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10008155 0 1
AT2G16730 BGAL13 beta-galactosidase 13, glycosy... Lus10020877 4.6 0.8649
AT3G01440 PnsL3, PQL2, PQ... PsbQ-like 2, Photosynthetic ND... Lus10036622 4.9 0.8918
AT5G62380 NAC ANAC101, VND6 VASCULAR-RELATED NAC-DOMAIN 6,... Lus10009858 4.9 0.8345
AT1G33970 P-loop containing nucleoside t... Lus10003732 4.9 0.8488
AT4G12140 RING/U-box superfamily protein... Lus10007628 13.2 0.7832
AT3G01440 PnsL3, PQL2, PQ... PsbQ-like 2, Photosynthetic ND... Lus10035839 15.7 0.8734
AT5G45890 SAG12 senescence-associated gene 12 ... Lus10020722 15.9 0.7968
AT1G61550 S-locus lectin protein kinase ... Lus10037730 17.5 0.8106
AT3G02100 UDP-Glycosyltransferase superf... Lus10015749 20.4 0.8074
AT2G47400 CP12-1 CP12 domain-containing protein... Lus10010006 20.6 0.8416

Lus10008155 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.