Lus10008162 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G40925 48 / 5e-07 F-box and associated interaction domains-containing protein (.1)
AT2G40910 44 / 1e-05 F-box and associated interaction domains-containing protein (.1.2)
AT2G15640 41 / 0.0001 F-box family protein (.1)
AT5G65850 41 / 0.0002 F-box and associated interaction domains-containing protein (.1)
AT1G46984 40 / 0.0003 F-box family protein (.1)
AT1G31080 40 / 0.0003 F-box family protein (.1)
AT1G11620 40 / 0.0004 F-box and associated interaction domains-containing protein (.1)
AT5G37040 39 / 0.0005 F-box family protein (.1)
AT3G17710 39 / 0.0005 F-box and associated interaction domains-containing protein (.1)
AT3G17280 39 / 0.0007 F-box and associated interaction domains-containing protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10000667 200 / 6e-65 ND 51 / 4e-07
Lus10000664 202 / 3e-64 AT3G23570 166 / 1e-48 alpha/beta-Hydrolases superfamily protein (.1)
Lus10007302 142 / 7e-41 AT1G15680 49 / 4e-06 F-box family protein (.1)
Lus10040838 141 / 5e-40 AT3G23950 57 / 2e-08 F-box family protein (.1)
Lus10002769 135 / 1e-39 AT1G15680 64 / 2e-11 F-box family protein (.1)
Lus10013987 139 / 1e-38 AT3G23950 59 / 1e-08 F-box family protein (.1)
Lus10016522 135 / 3e-37 AT2G37890 155 / 6e-42 Mitochondrial substrate carrier family protein (.1)
Lus10035796 133 / 3e-37 ND 45 / 1e-04
Lus10013986 133 / 7e-37 ND 55 / 7e-08
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.011G004800 79 / 8e-18 AT5G49610 65 / 3e-11 F-box family protein (.1)
Potri.011G000700 63 / 3e-12 AT3G15910 58 / 5e-09 unknown protein
Potri.004G000900 52 / 3e-08 AT4G12560 87 / 2e-18 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2)
Potri.013G067800 46 / 3e-06 AT5G07610 131 / 4e-34 F-box family protein (.1)
Potri.011G137200 44 / 1e-05 AT3G07870 94 / 1e-20 F-box and associated interaction domains-containing protein (.1)
Potri.010G254000 43 / 2e-05 AT5G07610 149 / 1e-40 F-box family protein (.1)
Potri.009G132400 43 / 3e-05 ND /
Potri.008G016300 42 / 5e-05 AT5G07610 53 / 2e-08 F-box family protein (.1)
Potri.005G043500 42 / 6e-05 AT5G07610 135 / 7e-36 F-box family protein (.1)
Potri.001G318400 42 / 0.0001 AT3G06240 142 / 3e-38 F-box family protein (.1)
PFAM info
Representative CDS sequence
>Lus10008162 pacid=23173773 polypeptide=Lus10008162 locus=Lus10008162.g ID=Lus10008162.BGIv1.0 annot-version=v1.0
ATGGCTATGATCGAGAATTGCAGTTCGTCGGATTGCGATGTGCCGCTAAGCTCATTCTTTGTCTGTTCCGACCCCGAAAAACGGCGCCGGATCAATCGGA
TCGGCAAACTGGGGAATGATCTCCTTGTAGAGATTCTAATTCGGCTTCCGAACCCAAGATCCTCCTGGTGCTGCAAAACCGTCTGCAAGCAATGGGGTTC
CGTCATCTCCGATCCCAGCTTCAATCGCCAGTTTATTGCTCGTCACCGCAGTAAGTACCAACCACCATCTCTGTTTCTTCCCGCACACGACCCGCAATCG
ATCCTCAGCTTTCTCCCCGTTCCTGATCGACCAAAATTGAGAGTGTTTGATTGCTTCAAGGACTTGCTTTTATGCGGGTTTGCTGAAGAATTTGGCGAAT
TGGAAAGATCCTACTTGATCTGCAATCCGTTTACGAAGCAATGGATCGCCCTTCCTTTAACAAATTGA
AA sequence
>Lus10008162 pacid=23173773 polypeptide=Lus10008162 locus=Lus10008162.g ID=Lus10008162.BGIv1.0 annot-version=v1.0
MAMIENCSSSDCDVPLSSFFVCSDPEKRRRINRIGKLGNDLLVEILIRLPNPRSSWCCKTVCKQWGSVISDPSFNRQFIARHRSKYQPPSLFLPAHDPQS
ILSFLPVPDRPKLRVFDCFKDLLLCGFAEEFGELERSYLICNPFTKQWIALPLTN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G60370 F-box and associated interacti... Lus10008162 0 1
AT1G02000 GAE2 UDP-D-glucuronate 4-epimerase ... Lus10031707 1.7 0.8175
AT1G50420 GRAS SCL-3, SCL3 scarecrow-like 3 (.1) Lus10016892 7.5 0.8063
AT2G32750 Exostosin family protein (.1) Lus10007426 9.7 0.7621
AT4G13750 EMB2597, NOV NO VEIN, EMBRYO DEFECTIVE 2597... Lus10037831 10.7 0.7156
AT5G03810 GDSL-like Lipase/Acylhydrolase... Lus10035585 15.0 0.7663
Lus10018970 24.0 0.7551
AT4G09900 ATMES12 ARABIDOPSIS THALIANA METHYL ES... Lus10009489 26.3 0.7633
AT5G06540 Pentatricopeptide repeat (PPR)... Lus10031424 27.5 0.7418
AT1G35670 CPK11, ATCDPK2,... calcium-dependent protein kina... Lus10006065 27.7 0.7371
AT1G31860 HISN2, AT-IE HISTIDINE BIOSYNTHESIS 2, hist... Lus10043483 28.9 0.7211

Lus10008162 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.