Lus10008164 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G20050 162 / 2e-51 HYD1 HYDRA1, C-8,7 sterol isomerase (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10027993 238 / 3e-81 AT1G20050 266 / 1e-90 HYDRA1, C-8,7 sterol isomerase (.1)
Lus10015386 233 / 2e-79 AT1G20050 261 / 1e-88 HYDRA1, C-8,7 sterol isomerase (.1)
Lus10032965 231 / 1e-78 AT1G20050 261 / 5e-89 HYDRA1, C-8,7 sterol isomerase (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G160500 194 / 7e-64 AT1G20050 269 / 4e-92 HYDRA1, C-8,7 sterol isomerase (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF05241 EBP EXPERA (EXPanded EBP superfamily)
Representative CDS sequence
>Lus10008164 pacid=23173783 polypeptide=Lus10008164 locus=Lus10008164.g ID=Lus10008164.BGIv1.0 annot-version=v1.0
ATGACAAACCGTTTGTTGACAGGGAAAGAATACAGCAAGGGTGATTCAAGATATGCAGCGAGAGATTCTGGTGTAGTCTCTGTGGAAGGCTTGACTGCAG
TCTTGGAAGGTCCAGCGTGCCTTTTAGCCGTATATGGTATTGCTGCAGGGAAGTCCTACAGCTACATACTGCAGTTTGCTATTTCTTTAGGCCAGCTATA
TGGAACTGCAGTCTATTTCATTACCGCTTATCTCGAAGGCGATAACTTTGCTGCCACTCCCTTTTACTACTGTGGCTACTACATTGGTGCAAATGCTTCC
TGGGTTGTCATACCTTCACTCATCGCCTTGCGCTGTTGGAGGAAGACTTGTCACGCCTTCAACGTCCAAGCAACATCCAGAAAGACCAAAATTCGCTGA
AA sequence
>Lus10008164 pacid=23173783 polypeptide=Lus10008164 locus=Lus10008164.g ID=Lus10008164.BGIv1.0 annot-version=v1.0
MTNRLLTGKEYSKGDSRYAARDSGVVSVEGLTAVLEGPACLLAVYGIAAGKSYSYILQFAISLGQLYGTAVYFITAYLEGDNFAATPFYYCGYYIGANAS
WVVIPSLIALRCWRKTCHAFNVQATSRKTKIR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G20050 HYD1 HYDRA1, C-8,7 sterol isomerase... Lus10008164 0 1
AT2G38150 alpha 1,4-glycosyltransferase ... Lus10002496 5.9 0.8670
AT5G65820 Pentatricopeptide repeat (PPR)... Lus10011566 6.3 0.8607
Lus10002317 13.2 0.8625
Lus10002764 14.5 0.8614
Lus10038295 18.2 0.8612
AT1G01180 S-adenosyl-L-methionine-depend... Lus10013195 21.9 0.8570
AT3G13000 Protein of unknown function, D... Lus10033328 22.9 0.8221
AT2G38150 alpha 1,4-glycosyltransferase ... Lus10027772 25.5 0.8539
AT4G00050 bHLH bHLH016, UNE10 unfertilized embryo sac 10, ba... Lus10003471 27.6 0.8512
AT2G19860 ATHXK2 ARABIDOPSIS THALIANA HEXOKINAS... Lus10034980 28.0 0.8387

Lus10008164 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.