Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G02820 57 / 4e-12 Late embryogenesis abundant 3 (LEA3) family protein (.1) AT4G02380 55 / 1e-11 SAG21, ATLEA5 Arabidopsis thaliana late embryogenensis abundant like 5, senescence-associated gene 21 (.1.2) AT3G53770 47 / 2e-08 late embryogenesis abundant 3 (LEA3) family protein (.1), late embryogenesis abundant 3 (LEA3) family protein (.2) AT4G15910 47 / 3e-08 ATDI21 drought-induced 21 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10027987 [exp] 76 / 1e-19 AT1G02820 67 / 5e-16 Late embryogenesis abundant 3 (LEA3) family protein (.1) Lus10027986 [exp] 70 / 3e-17 AT1G02820 78 / 3e-20 Late embryogenesis abundant 3 (LEA3) family protein (.1) Lus10008170 [exp] 67 / 2e-16 AT4G02380 83 / 3e-22 Arabidopsis thaliana late embryogenensis abundant like 5, senescence-associated gene 21 (.1.2) Lus10042672 [exp] 52 / 4e-10 AT4G02380 63 / 2e-14 Arabidopsis thaliana late embryogenensis abundant like 5, senescence-associated gene 21 (.1.2) Lus10029634 [exp] 49 / 3e-09 AT4G02380 57 / 4e-12 Arabidopsis thaliana late embryogenensis abundant like 5, senescence-associated gene 21 (.1.2) Lus10006508 [exp] 44 / 5e-07 AT4G15910 73 / 2e-18 drought-induced 21 (.1) Lus10037497 [exp] 41 / 8e-06 AT4G15910 73 / 5e-18 drought-induced 21 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G203500 [exp] 69 / 4e-17 AT4G02380 74 / 1e-18 Arabidopsis thaliana late embryogenensis abundant like 5, senescence-associated gene 21 (.1.2) Potri.014G127700 [exp] 63 / 1e-14 AT4G02380 79 / 1e-20 Arabidopsis thaliana late embryogenensis abundant like 5, senescence-associated gene 21 (.1.2) Potri.010G012100 [exp] 44 / 6e-07 AT4G15910 83 / 6e-22 drought-induced 21 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF03242 [flax] [poplar] LEA_3 Late embryogenesis abundant protein
Representative CDS sequence Show only first row Show all	>Lus10008169 pacid=23173781 polypeptide=Lus10008169 locus=Lus10008169.g ID=Lus10008169.BGIv1.0 annot-version=v1.0 ATGTCTCGCACTTGCGCAACCGTCATCAGGGCAATCAGAAGCAGCAGGGGAATCTCATCCGCCGCCGCGGCGCCCGCAATCGTGAAGAAAGTACCTGTTT CCGCCGCAAAGAAAACCGGGGAGGAGGCGGCAGCGGGTAAACAGAGCTGGATTCCTGACCCGAGAACTGGATTCTACCGACCCGAGCATGTCACCGAGGA GATCGACGCAGCCGAGCTACGCGCTCTACTCTTGAAGAAACACTGA
AA sequence Show only first row Show all	>Lus10008169 pacid=23173781 polypeptide=Lus10008169 locus=Lus10008169.g ID=Lus10008169.BGIv1.0 annot-version=v1.0 MSRTCATVIRAIRSSRGISSAAAAPAIVKKVPVSAAKKTGEEAAAGKQSWIPDPRTGFYRPEHVTEEIDAAELRALLLKKH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G02820			Late embryogenesis abundant 3 ...		Lus10008169 [exp]	0	1
AT4G02380		SAG21, ATLEA5	Arabidopsis thaliana late embr...		Lus10008170 [exp]	5.1	0.9393
AT4G12080	AT-hook	ATAHL1, AHL1	AT-hook motif nuclear-localize...		Lus10003371 [exp]	10.0	0.9381
AT4G17550		AtG3Pp4	glycerol-3-phosphate permease ...		Lus10004358 [exp]	12.3	0.8810
AT1G71696		SOL1.4, SOL1.3,...	SUPPRESSOR OF LLP1 1, carboxyp...		Lus10028694 [exp]	19.1	0.9328
AT4G13430		ATLEUC1, IIL1	isopropyl malate isomerase lar...		Lus10014463 [exp]	20.1	0.9237
AT2G28360			SIT4 phosphatase-associated fa...		Lus10016089 [exp]	21.9	0.9099
AT3G18830		ATPMT5, AtPLT5	ARABIDOPSIS THALIANA POLYOL/MO...		Lus10035255 [exp]	23.0	0.9201
AT3G23230	AP2_ERF	ERF98	Integrase-type DNA-binding sup...		Lus10022936 [exp]	25.1	0.9296
AT5G61930		APO3	ACCUMULATION OF PHOTOSYSTEM ON...		Lus10041934 [exp]	26.2	0.8906
AT4G26900		HISN4, HISHF, A...	HIS HF (.1)		Lus10043113 [exp]	26.5	0.9220

Compare expression of checked genes

Lus10008169 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.