Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G02250 113 / 5e-32 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT1G55770 100 / 1e-26 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT1G62760 59 / 1e-10 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT5G62360 58 / 2e-10 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT1G02550 57 / 3e-10 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT1G14890 53 / 9e-09 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT1G70720 53 / 1e-08 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT5G38610 52 / 2e-08 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT5G46940 50 / 1e-07 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT3G36659 50 / 1e-07 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10001464 [exp] 305 / 2e-107 AT4G02250 112 / 1e-31 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10015199 [exp] 88 / 6e-22 AT5G46940 67 / 8e-14 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10031483 [exp] 88 / 7e-22 AT5G46940 64 / 8e-13 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10019498 [exp] 67 / 5e-14 AT5G46970 87 / 1e-21 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10029877 [exp] 66 / 3e-13 AT5G64620 67 / 7e-14 cell wall / vacuolar inhibitor of fructosidase 2 (.1) Lus10017347 [exp] 64 / 1e-12 AT3G17220 81 / 2e-19 pectin methylesterase inhibitor 2 (.1) Lus10028910 [exp] 64 / 1e-12 AT1G62760 169 / 1e-51 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10020664 [exp] 62 / 3e-12 AT5G64620 67 / 2e-14 cell wall / vacuolar inhibitor of fructosidase 2 (.1) Lus10001658 [exp] 62 / 6e-12 AT1G48020 86 / 4e-21 ARABIDOPSIS THALIANA PECTIN METHYLESTERASE INHIBITOR 1, pectin methylesterase inhibitor 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G016500 [exp] 165 / 4e-52 AT4G02250 73 / 2e-16 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.001G127500 [exp] 132 / 3e-39 AT4G02250 98 / 3e-26 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.006G134900 [exp] 81 / 3e-19 AT5G64620 76 / 2e-17 cell wall / vacuolar inhibitor of fructosidase 2 (.1) Potri.014G044100 [exp] 80 / 9e-19 AT5G46940 111 / 3e-31 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.003G086500 [exp] 78 / 8e-18 AT5G46940 119 / 6e-34 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.003G086600 [exp] 74 / 1e-16 AT5G38610 123 / 2e-35 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.015G128300 [exp] 62 / 7e-12 AT5G62360 192 / 1e-62 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.015G128100 [exp] 57 / 3e-10 AT5G62360 221 / 1e-73 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.012G127400 [exp] 56 / 5e-10 AT4G25250 150 / 7e-46 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.010G109300 [exp] 56 / 8e-10 AT1G14890 218 / 5e-72 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF04043 [flax] [poplar] PMEI Plant invertase/pectin methylesterase inhibitor
Representative CDS sequence Show only first row Show all	>Lus10008201 pacid=23164913 polypeptide=Lus10008201 locus=Lus10008201.g ID=Lus10008201.BGIv1.0 annot-version=v1.0 ATGAAGCCTTTCTATATTCCATTTTTAATATCTCTAATCTCATTATTAACCATATTCCCACACCCTAATGAAGCACTCGGCCATGGCAACAACAACCTCA TCAAAGATGTTTGTTCGAAAACCCTAGAGAGGGAAGACTGCCTCGCCAGCCTAGCACCCATAAAAGGTAGTCAACTCGAGACATTGCCCGAACTGGGTGT AATCGCTTTGAAGCTCGCGAGCAAAAACGCGACCAAGACCTCTGCCTACATCAAGAGAATGTTGAGCAACCAGGCCCTGGGCCCCATGGTCGAACAGACT CTCCAAAACTGCTTCGAGCAATACTTGGACGCTGTCGACCAGCTGGACGATTCCATGGCGGCATTGCTAGCCAATGCCACCGCGGATGTCCAGACGTGGG TCTCAGCTGCCATGTCGGATGTTGTGTCATGCGACGAAGGTTTGAAGGAGAGTAGTGGGTTGGAGGCGTCGGTGTTGTCGCGTAGGAATTCCGGGTTCCG ACAGTTGTGTGGCACTGTCTTGGCTATCAACAACCTATTCGCCAAAACTTTGTGA
AA sequence Show only first row Show all	>Lus10008201 pacid=23164913 polypeptide=Lus10008201 locus=Lus10008201.g ID=Lus10008201.BGIv1.0 annot-version=v1.0 MKPFYIPFLISLISLLTIFPHPNEALGHGNNNLIKDVCSKTLEREDCLASLAPIKGSQLETLPELGVIALKLASKNATKTSAYIKRMLSNQALGPMVEQT LQNCFEQYLDAVDQLDDSMAALLANATADVQTWVSAAMSDVVSCDEGLKESSGLEASVLSRRNSGFRQLCGTVLAINNLFAKTL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G02250			Plant invertase/pectin methyle...		Lus10008201 [exp]	0	1
AT5G13930		ATCHS, TT4, CHS	TRANSPARENT TESTA 4, CHALCONE ...		Lus10023670 [exp]	4.0	0.8575
AT5G13930		ATCHS, TT4, CHS	TRANSPARENT TESTA 4, CHALCONE ...		Lus10011745 [exp]	6.5	0.8334
AT5G07990		CYP75B1, D501, ...	TRANSPARENT TESTA 7, CYTOCHROM...		Lus10021158 [exp]	8.7	0.8009
AT5G07990		CYP75B1, D501, ...	TRANSPARENT TESTA 7, CYTOCHROM...		Lus10040526 [exp]	11.7	0.7862
					Lus10006529 [exp]	14.7	0.7224
AT3G52490			Double Clp-N motif-containing ...		Lus10024536 [exp]	16.1	0.7224
					Lus10013260 [exp]	17.3	0.7224
AT3G13790		ATCWINV1, ATBFR...	ARABIDOPSIS THALIANA CELL WALL...		Lus10015614 [exp]	18.5	0.7224
AT5G45840			Leucine-rich repeat protein ki...		Lus10025400 [exp]	19.3	0.7047
					Lus10035557 [exp]	19.7	0.7224

Compare expression of checked genes

Lus10008201 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.