Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G50335 49 / 2e-09 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10001469 [exp] 89 / 3e-25 AT5G50335 56 / 6e-12 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G094000 [exp] 60 / 7e-14 AT5G50335 / unknown protein Potri.015G091300 [exp] 56 / 5e-12 AT5G50335 / unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10008207 pacid=23164935 polypeptide=Lus10008207 locus=Lus10008207.g ID=Lus10008207.BGIv1.0 annot-version=v1.0 ATGACAAAAGAAGTGAAAGATCATTGCAGTTATTGTCATCATCAGCAGCAGCAGCAGCAACAGATGCTTCAGTGCAACAAAGGGAAAGTGAAGAAATTCA AGAGGAGCAGCTCTAACCTGGAGGAGGATGGTGTTTCCTCTGCCCTTTTCTTCCTTGCTTGCATTGCCAACATCACTACTACTACTTCTTCTTCTTCTTC TTCTTCTTGA
AA sequence Show only first row Show all	>Lus10008207 pacid=23164935 polypeptide=Lus10008207 locus=Lus10008207.g ID=Lus10008207.BGIv1.0 annot-version=v1.0 MTKEVKDHCSYCHHQQQQQQQMLQCNKGKVKKFKRSSSNLEEDGVSSALFFLACIANITTTTSSSSSSS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G50335			unknown protein		Lus10008207 [exp]	0	1
AT5G50335			unknown protein		Lus10001469 [exp]	2.4	0.9140
AT3G24670			Pectin lyase-like superfamily ...		Lus10022817 [exp]	5.7	0.9059
AT5G42030		ABIL4	ABL interactor-like protein 4 ...		Lus10034928 [exp]	6.2	0.8170
AT1G69780	HD	ATHB13	Homeobox-leucine zipper protei...		Lus10030493 [exp]	7.2	0.8780
AT1G23965			unknown protein		Lus10030844 [exp]	7.3	0.8883
AT5G35670		IQD33	IQ-domain 33 (.1)		Lus10000919 [exp]	8.1	0.8293
AT1G74160			unknown protein		Lus10034678 [exp]	12.0	0.8302
AT1G69780	HD	ATHB13	Homeobox-leucine zipper protei...		Lus10012845 [exp]	12.2	0.8368
AT1G74670		GASA6	GA-stimulated Arabidopsis 6, G...		Lus10008612 [exp]	13.7	0.8113
AT4G11290			Peroxidase superfamily protein...		Lus10039681 [exp]	14.3	0.7341

Compare expression of checked genes

Lus10008207 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.