Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G19510 105 / 4e-27 Disease resistance protein (TIR-NBS-LRR class) (.1), Disease resistance protein (TIR-NBS-LRR class) (.2) AT5G51630 101 / 1e-25 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2), Disease resistance protein (TIR-NBS-LRR class) family (.3) AT4G16990 98 / 2e-24 RLM3 RESISTANCE TO LEPTOSPHAERIA MACULANS 3, disease resistance protein (TIR-NBS class), putative AT4G16950 97 / 4e-24 RPP5 RECOGNITION OF PERONOSPORA PARASITICA 5, Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) AT4G16900 96 / 7e-24 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT4G11170 96 / 1e-23 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT4G16890 96 / 2e-23 BAL, SNC1 SUPPRESSOR OF NPR1-1, CONSTITUTIVE 1, BALL, disease resistance protein (TIR-NBS-LRR class), putative (.1) AT2G20142 93 / 3e-23 Toll-Interleukin-Resistance (TIR) domain family protein (.1) AT5G49140 94 / 6e-23 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT5G46470 94 / 7e-23 RPS6 RESISTANT TO P. SYRINGAE 6, disease resistance protein (TIR-NBS-LRR class) family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10007030 [exp] 232 / 2e-73 AT4G12010 316 / 3e-94 Disease resistance protein (TIR-NBS-LRR class) family (.1) Lus10042777 [exp] 212 / 1e-70 AT3G44630 136 / 2e-36 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2), Disease resistance protein (TIR-NBS-LRR class) family (.3) Lus10015648 [exp] 224 / 9e-69 AT4G12010 420 / 1e-126 Disease resistance protein (TIR-NBS-LRR class) family (.1) Lus10017418 [exp] 209 / 3e-63 AT5G44510 335 / 1e-96 target of AVRB operation1 (.1) Lus10017419 [exp] 197 / 3e-61 AT4G12010 272 / 9e-80 Disease resistance protein (TIR-NBS-LRR class) family (.1) Lus10024149 [exp] 188 / 8e-59 AT4G19510 213 / 8e-61 Disease resistance protein (TIR-NBS-LRR class) (.1), Disease resistance protein (TIR-NBS-LRR class) (.2) Lus10010222 [exp] 184 / 8e-59 AT4G11170 169 / 2e-47 Disease resistance protein (TIR-NBS-LRR class) family (.1) Lus10010221 [exp] 190 / 8e-57 AT5G17680 369 / 4e-109 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10015650 [exp] 177 / 3e-52 AT4G12010 346 / 3e-103 Disease resistance protein (TIR-NBS-LRR class) family (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G096849 [exp] 113 / 3e-32 AT5G36930 167 / 4e-48 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.013G098100 [exp] 109 / 4e-31 AT5G36930 159 / 1e-45 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.019G098600 [exp] 109 / 8e-31 AT2G20142 138 / 4e-40 Toll-Interleukin-Resistance (TIR) domain family protein (.1) Potri.013G097050 [exp] 108 / 2e-30 AT5G36930 158 / 3e-45 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.019G069866 [exp] 107 / 8e-30 AT4G12010 179 / 4e-52 Disease resistance protein (TIR-NBS-LRR class) family (.1) Potri.013G098550 [exp] 112 / 1e-29 AT5G17680 593 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.019G098900 [exp] 111 / 4e-29 AT5G17680 477 / 6e-148 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.017G105501 [exp] 102 / 2e-28 AT5G36930 158 / 4e-45 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.019G095932 [exp] 107 / 8e-28 AT4G11170 294 / 5e-88 Disease resistance protein (TIR-NBS-LRR class) family (.1) Potri.019G070393 [exp] 107 / 1e-27 AT5G17680 629 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0173 [flax] [poplar] STIR PF01582 [flax] [poplar] TIR TIR domain
Representative CDS sequence Show only first row Show all	>Lus10008209 pacid=23164909 polypeptide=Lus10008209 locus=Lus10008209.g ID=Lus10008209.BGIv1.0 annot-version=v1.0 ATGTCTCCTCCTTATATTGGAGAATGGGACTACGATACCTTCTTCTGTTTCAGAGGTGACGACACACGCTATGGTTTCACCAGCCACCTCATGGCTGCTC TGTCTAATCGGCAAATCAGAACCTTCATCGACGCCAAGCTCCAAAAAACTAGGAGCATGGACGAGCTCATCTCCATCCTTCAAAGGTCCGCTATTTTCTT GGTGGTTTTTTCTGAGAAGTTTGCTGATTCCTACTGGTGCTTGGATGAGGTGGTCACCATAGCTCAAAGGATGACAGAGTTCGGACATCGAGTTCTACCA ATTTTCTACACAGTGGATCCATCTGACGTTGCAGATGATTGTAGGAGCTATGCGGCTACCATTGATCGTCAATATAAAGCCAGAAGTACTTACTTAGAGG ATAAGAAGAGATGGATGGATGGATGCTTTGAATGTAGTGGCTAA
AA sequence Show only first row Show all	>Lus10008209 pacid=23164909 polypeptide=Lus10008209 locus=Lus10008209.g ID=Lus10008209.BGIv1.0 annot-version=v1.0 MSPPYIGEWDYDTFFCFRGDDTRYGFTSHLMAALSNRQIRTFIDAKLQKTRSMDELISILQRSAIFLVVFSEKFADSYWCLDEVVTIAQRMTEFGHRVLP IFYTVDPSDVADDCRSYAATIDRQYKARSTYLEDKKRWMDGCFECSG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G19510			Disease resistance protein (TI...		Lus10008209 [exp]	0	1
AT5G14090			unknown protein		Lus10037042 [exp]	1.4	0.9552
AT5G59320		LTP3	lipid transfer protein 3 (.1)		Lus10024201 [exp]	1.7	0.9512
AT5G22580			Stress responsive A/B Barrel D...		Lus10020555 [exp]	2.0	0.9547
AT5G22580			Stress responsive A/B Barrel D...		Lus10009407 [exp]	2.0	0.9489
AT3G44900		ATCHX4	cation/H+ exchanger 4, cation/...		Lus10032622 [exp]	5.9	0.9217
AT1G56260		MDO1	MERISTEM DISORGANIZATION 1, un...		Lus10020669 [exp]	6.3	0.9201
					Lus10034389 [exp]	7.7	0.9222
					Lus10012064 [exp]	9.1	0.8723
AT1G07400			HSP20-like chaperones superfam...		Lus10022604 [exp]	9.2	0.9126
AT5G08350			GRAM domain-containing protein...		Lus10017372 [exp]	9.5	0.8844

Compare expression of checked genes

Lus10008209 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.