Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008220 [exp] 129 / 3e-40 AT5G44005 55 / 4e-11 unknown protein Lus10003609 [exp] 128 / 6e-40 AT5G44005 51 / 9e-10 unknown protein Lus10003610 [exp] 123 / 6e-38 AT5G44005 59 / 1e-12 unknown protein Lus10008224 [exp] 123 / 6e-38 AT5G44005 57 / 6e-12 unknown protein Lus10003608 [exp] 110 / 8e-33 AT5G44005 55 / 4e-11 unknown protein Lus10008222 [exp] 92 / 5e-23 AT4G12010 327 / 4e-96 Disease resistance protein (TIR-NBS-LRR class) family (.1) Lus10024940 [exp] 78 / 2e-20 ND 42 / 2e-06 Lus10003607 [exp] 63 / 3e-14 ND 48 / 2e-08 Lus10008219 [exp] 59 / 8e-12 AT5G44005 56 / 2e-10 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G257600 [exp] 45 / 3e-07 ND / Potri.014G192100 [exp] 42 / 2e-06 AT5G44005 49 / 4e-09 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10008223 pacid=23164911 polypeptide=Lus10008223 locus=Lus10008223.g ID=Lus10008223.BGIv1.0 annot-version=v1.0 ATGAAAAGAATCCAGTTCTTGAGGTCTGGGAAGAGACTTGCTAGTAGCACCAGCTTTACCAGATCATCTTCAGCTGTTGCTGCCGTAGCCATTGCTGTGG GGAGTAAAAGAAAGGGTGGTCCTTTGGGTTGGTGGAGTAGCAGGTCTTATGTGCCAAAGAAATGGGTCAACAAGTTCAAGGCACAGTGGAAGAGGGCAAT TGGTTGGAGGAAGAGCAGCAGTTGTGTTGAGTATAGATATGATATACAGAGCTATTCCCTCAACTTTGATGATGGTGCCTGCAACCATTCTTCAACAGTT AAATAG
AA sequence Show only first row Show all	>Lus10008223 pacid=23164911 polypeptide=Lus10008223 locus=Lus10008223.g ID=Lus10008223.BGIv1.0 annot-version=v1.0 MKRIQFLRSGKRLASSTSFTRSSSAVAAVAIAVGSKRKGGPLGWWSSRSYVPKKWVNKFKAQWKRAIGWRKSSSCVEYRYDIQSYSLNFDDGACNHSSTV K

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10008223 [exp]	0	1
AT1G78610		MSL6	mechanosensitive channel of sm...		Lus10000913 [exp]	2.2	0.8447
AT2G39840		TOPP4	type one serine/threonine prot...		Lus10021872 [exp]	5.0	0.8302
AT1G66140	C2H2ZnF	ZFP4	zinc finger protein 4 (.1)		Lus10026597 [exp]	6.6	0.8321
AT4G03510		ATRMA1, RMA1	RING membrane-anchor 1 (.1.2)		Lus10018489 [exp]	7.5	0.8059
AT3G16500	AUX_IAA	IAA26, PAP1	indole-3-acetic acid inducible...		Lus10037587 [exp]	9.2	0.8118
AT4G24060	DOF	AtDof4,6	Dof-type zinc finger DNA-bindi...		Lus10003207 [exp]	9.5	0.8223
AT3G09880		ATB' BETA, ATB'...	Protein phosphatase 2A regulat...		Lus10022612 [exp]	9.8	0.8132
AT1G35420			alpha/beta-Hydrolases superfam...		Lus10000375 [exp]	12.0	0.8174
AT1G71140			MATE efflux family protein (.1...		Lus10041053 [exp]	12.6	0.8094
AT5G17820			Peroxidase superfamily protein...		Lus10001324 [exp]	12.9	0.8402

Compare expression of checked genes

Lus10008223 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.