Lus10008243 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G28556 90 / 2e-22 RIC7 PAK-box/P21-Rho-binding family protein (.1)
AT2G33460 89 / 3e-22 RIC1 ROP-interactive CRIB motif-containing protein 1 (.1)
AT3G23380 88 / 4e-22 RIC5 ROP-interactive CRIB motif-containing protein 5 (.1)
AT2G20430 83 / 4e-20 RIC6 ROP-interactive CRIB motif-containing protein 6 (.1)
AT1G04450 81 / 4e-19 RIC3 ROP-interactive CRIB motif-containing protein 3 (.1)
AT4G04900 69 / 2e-15 RIC10 ROP-interactive CRIB motif-containing protein 10 (.1)
AT1G03982 61 / 8e-12 PAK-box/P21-Rho-binding family protein (.1)
AT1G61795 50 / 2e-08 PAK-box/P21-Rho-binding family protein (.1)
AT4G21745 49 / 9e-08 PAK-box/P21-Rho-binding family protein (.1)
AT5G16490 39 / 0.0004 RIC4 ROP-interactive CRIB motif-containing protein 4 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10003625 238 / 3e-81 AT4G28556 94 / 3e-24 PAK-box/P21-Rho-binding family protein (.1)
Lus10018362 71 / 2e-15 AT4G04900 94 / 2e-24 ROP-interactive CRIB motif-containing protein 10 (.1)
Lus10006763 68 / 2e-14 AT4G04900 81 / 2e-19 ROP-interactive CRIB motif-containing protein 10 (.1)
Lus10007648 67 / 3e-14 AT4G04900 88 / 2e-22 ROP-interactive CRIB motif-containing protein 10 (.1)
Lus10011805 65 / 5e-13 AT2G33460 97 / 2e-24 ROP-interactive CRIB motif-containing protein 1 (.1)
Lus10021168 51 / 1e-07 AT2G33460 81 / 3e-17 ROP-interactive CRIB motif-containing protein 1 (.1)
Lus10020060 49 / 3e-07 AT3G54200 72 / 4e-15 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G227500 102 / 3e-27 AT4G28556 106 / 5e-28 PAK-box/P21-Rho-binding family protein (.1)
Potri.002G035500 96 / 1e-24 AT2G20430 105 / 1e-27 ROP-interactive CRIB motif-containing protein 6 (.1)
Potri.010G069500 88 / 3e-21 AT4G28556 99 / 1e-24 PAK-box/P21-Rho-binding family protein (.1)
Potri.008G168900 80 / 2e-18 AT2G33460 101 / 4e-26 ROP-interactive CRIB motif-containing protein 1 (.1)
Potri.004G020650 74 / 4e-17 AT4G04900 73 / 1e-16 ROP-interactive CRIB motif-containing protein 10 (.1)
Potri.011G025300 73 / 1e-16 AT4G04900 89 / 5e-23 ROP-interactive CRIB motif-containing protein 10 (.1)
Potri.002G233400 53 / 8e-09 AT5G16490 89 / 1e-22 ROP-interactive CRIB motif-containing protein 4 (.1)
Potri.013G086600 41 / 9e-05 AT5G16490 109 / 7e-31 ROP-interactive CRIB motif-containing protein 4 (.1)
Potri.019G053300 40 / 0.0002 AT5G16490 108 / 2e-30 ROP-interactive CRIB motif-containing protein 4 (.1)
Potri.014G147000 39 / 0.0005 AT5G16490 76 / 8e-18 ROP-interactive CRIB motif-containing protein 4 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00786 PBD P21-Rho-binding domain
Representative CDS sequence
>Lus10008243 pacid=23164914 polypeptide=Lus10008243 locus=Lus10008243.g ID=Lus10008243.BGIv1.0 annot-version=v1.0
ATGAAAGGTCTCTTGAAGGGCCTGCGATACATTTCTCAGATATTCGATGATGAAGAAAAGGAGCCAGAAATGCAGATTGGTAACCCTACAGATGTAAAAC
ATGTTGCTCACATTGGTTGGGATGCCAACAATGACGGTCCTCCCACTTGGATGAACGGATTCCAGGAGCAACCAGGATCACCGGGAGGAGGAAAGAAGTC
GTCGGAGCATCCAAAATCATCCAGACGGAAGTCAGCAGCCGGTAATGAATCGGACAACAAGCACAATAAGAAAACTTCCCGACACACCAAAAAGGAGAAT
CAGTCGTCGGAGAAAGCAAAATCGACAGGGAGGAGTAGTTGCAAGGACGAAGTTGAAGTGGGGAGTAGCCAGGTGGATGCACCAAAGAAAGTGAGGAGGA
AGAAATCAAAAGAATCGGAGGTCGAAGGTTCGAAATCCAGGCCGAAAGCTGCAGCTGTAATTAGTACTCCAATGGAAGAAGGACGAGGCCATGGCGGGTT
TACTTAA
AA sequence
>Lus10008243 pacid=23164914 polypeptide=Lus10008243 locus=Lus10008243.g ID=Lus10008243.BGIv1.0 annot-version=v1.0
MKGLLKGLRYISQIFDDEEKEPEMQIGNPTDVKHVAHIGWDANNDGPPTWMNGFQEQPGSPGGGKKSSEHPKSSRRKSAAGNESDNKHNKKTSRHTKKEN
QSSEKAKSTGRSSCKDEVEVGSSQVDAPKKVRRKKSKESEVEGSKSRPKAAAVISTPMEEGRGHGGFT

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G28556 RIC7 PAK-box/P21-Rho-binding family... Lus10008243 0 1
AT2G24130 Leucine-rich receptor-like pro... Lus10022180 1.4 0.8701
AT1G15330 AtPV42a Cystathionine beta-synthase (C... Lus10004227 3.3 0.8704
AT3G04720 HEL, PR-4, PR4 HEVEIN-LIKE, pathogenesis-rela... Lus10020250 8.2 0.7953
AT2G18370 Bifunctional inhibitor/lipid-t... Lus10038429 27.9 0.8509
AT4G16120 ATSEB1, COBL7 ARABIDOPSIS THALIANA SEC61 BET... Lus10010023 49.7 0.7621
AT4G08180 ORP1C OSBP(oxysterol binding protein... Lus10025695 57.9 0.7741
AT1G02520 MDR8, ABCB11, P... multi-drug resistance 8, ATP-b... Lus10004519 77.5 0.8178
AT5G22210 unknown protein Lus10043407 81.6 0.7702
AT1G80320 2-oxoglutarate (2OG) and Fe(II... Lus10041279 92.3 0.7992
AT3G11080 AtRLP35 receptor like protein 35 (.1) Lus10028053 100.3 0.7628

Lus10008243 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.