Lus10008246 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G20450 228 / 1e-78 Ribosomal protein L14 (.1)
AT4G27090 227 / 3e-78 Ribosomal protein L14 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10024918 254 / 9e-89 AT2G20450 224 / 3e-77 Ribosomal protein L14 (.1)
Lus10011807 253 / 2e-88 AT2G20450 221 / 9e-76 Ribosomal protein L14 (.1)
Lus10021170 250 / 2e-87 AT2G20450 218 / 1e-74 Ribosomal protein L14 (.1)
Lus10003627 157 / 3e-51 AT4G27090 139 / 2e-44 Ribosomal protein L14 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G168600 239 / 3e-83 AT4G27090 230 / 2e-79 Ribosomal protein L14 (.1)
Potri.005G227300 238 / 2e-82 AT4G27090 235 / 3e-81 Ribosomal protein L14 (.1)
Potri.002G035700 236 / 6e-82 AT4G27090 234 / 8e-81 Ribosomal protein L14 (.1)
Potri.010G069900 235 / 2e-81 AT4G27090 228 / 2e-78 Ribosomal protein L14 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0107 KOW PF01929 Ribosomal_L14e Ribosomal protein L14
Representative CDS sequence
>Lus10008246 pacid=23164906 polypeptide=Lus10008246 locus=Lus10008246.g ID=Lus10008246.BGIv1.0 annot-version=v1.0
ATGGGTTTCAAGAGGTACGTGGAGATCGGTAGAGTGGCGCTCATCAACTACGGCAAGGACTACGGAAAGCTCGTGGTCATCGTCGATGTCGTTGATCAGA
ACAGGGCTCTGGTTGATGCACCAGACATGGTGAGGAGCCAGCTGAACTTCAAGAGGCTAACACTCACCGATATCAAGATTGAGATCAACAGGGTTCCCAA
GAAGAAGACACTGATTGAAGCAATGGAGAAAGCAGACGTTAAGGGGAAGTGGGAGAGCAGTTCGTGGGGAAGGAAGCTGATTGTCCAGAAGAGGAGAGCC
GCTCTCACCGATTTTGACAGGTTCAAGGTCATGCTGGCTAAGATAAAGAGAGGAGGGCTGGTCAGGCAGGAGCTTGCGAAACTGAAAAAGACGTCTGCCT
AG
AA sequence
>Lus10008246 pacid=23164906 polypeptide=Lus10008246 locus=Lus10008246.g ID=Lus10008246.BGIv1.0 annot-version=v1.0
MGFKRYVEIGRVALINYGKDYGKLVVIVDVVDQNRALVDAPDMVRSQLNFKRLTLTDIKIEINRVPKKKTLIEAMEKADVKGKWESSSWGRKLIVQKRRA
ALTDFDRFKVMLAKIKRGGLVRQELAKLKKTSA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G20450 Ribosomal protein L14 (.1) Lus10008246 0 1
AT5G50810 TIM8 translocase inner membrane sub... Lus10022450 1.0 0.9601
AT5G56670 Ribosomal protein S30 family p... Lus10017473 2.4 0.9302
AT3G18760 Translation elongation factor... Lus10006729 2.8 0.9193
AT1G34030 Ribosomal protein S13/S18 fami... Lus10014676 5.8 0.9383
AT5G40080 Mitochondrial ribosomal protei... Lus10003002 6.0 0.9148
AT3G10090 Nucleic acid-binding, OB-fold-... Lus10016222 6.9 0.9202
AT3G11500 Small nuclear ribonucleoprotei... Lus10017019 7.5 0.9131
AT2G34520 RPS14 mitochondrial ribosomal protei... Lus10034657 9.0 0.8953
AT5G56710 Ribosomal protein L31e family ... Lus10037703 10.2 0.9236
AT4G13720 Inosine triphosphate pyrophosp... Lus10011757 11.1 0.8817

Lus10008246 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.