Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G18560 97 / 4e-25 UDP-Glycosyltransferase superfamily protein (.1) AT2G29730 97 / 1e-24 UGT71D1 UDP-glucosyl transferase 71D1 (.1) AT2G18570 94 / 7e-24 UDP-Glycosyltransferase superfamily protein (.1) AT5G03490 94 / 2e-23 UDP-Glycosyltransferase superfamily protein (.1) AT2G29710 93 / 2e-23 UDP-Glycosyltransferase superfamily protein (.1) AT5G49690 92 / 6e-23 UDP-Glycosyltransferase superfamily protein (.1) AT1G07250 90 / 2e-22 UGT71C4 UDP-glucosyl transferase 71C4 (.1) AT4G36770 90 / 3e-22 UDP-Glycosyltransferase superfamily protein (.1) AT5G26310 89 / 8e-22 UGT72E3 UDP-Glycosyltransferase superfamily protein (.1) AT3G16520 89 / 9e-22 UGT88A1 UDP-glucosyl transferase 88A1 (.1.2.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10043445 [exp] 127 / 9e-36 AT5G65550 225 / 3e-68 UDP-Glycosyltransferase superfamily protein (.1) Lus10006280 [exp] 110 / 2e-29 AT5G65550 179 / 6e-51 UDP-Glycosyltransferase superfamily protein (.1) Lus10028865 [exp] 107 / 1e-28 AT5G49690 191 / 1e-55 UDP-Glycosyltransferase superfamily protein (.1) Lus10008956 [exp] 102 / 1e-26 AT5G65550 189 / 1e-54 UDP-Glycosyltransferase superfamily protein (.1) Lus10028864 [exp] 100 / 2e-26 AT5G65550 154 / 1e-42 UDP-Glycosyltransferase superfamily protein (.1) Lus10008955 [exp] 99 / 3e-25 AT5G49690 190 / 4e-55 UDP-Glycosyltransferase superfamily protein (.1) Lus10028863 [exp] 98 / 3e-25 AT5G65550 183 / 1e-52 UDP-Glycosyltransferase superfamily protein (.1) Lus10039037 [exp] 94 / 1e-23 AT1G07250 378 / 8e-127 UDP-glucosyl transferase 71C4 (.1) Lus10026793 [exp] 92 / 6e-23 AT3G21780 407 / 4e-138 UDP-glucosyl transferase 71B6 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G016500 [exp] 100 / 1e-25 AT3G21790 479 / 1e-166 UDP-Glycosyltransferase superfamily protein (.1) Potri.016G017166 [exp] 97 / 4e-25 AT3G21760 426 / 6e-148 HYPOSTATIN RESISTANCE 1, UDP-Glycosyltransferase superfamily protein (.1) Potri.008G024900 [exp] 97 / 8e-25 AT5G65550 173 / 7e-49 UDP-Glycosyltransferase superfamily protein (.1) Potri.016G017400 [exp] 97 / 8e-25 AT3G21790 474 / 9e-165 UDP-Glycosyltransferase superfamily protein (.1) Potri.009G044600 [exp] 97 / 9e-25 AT2G29730 488 / 2e-170 UDP-glucosyl transferase 71D1 (.1) Potri.016G017232 [exp] 95 / 5e-24 AT3G21760 500 / 7e-175 HYPOSTATIN RESISTANCE 1, UDP-Glycosyltransferase superfamily protein (.1) Potri.016G017300 [exp] 95 / 7e-24 AT3G21780 477 / 5e-166 UDP-glucosyl transferase 71B6 (.1) Potri.006G007300 [exp] 94 / 1e-23 AT3G21790 427 / 4e-146 UDP-Glycosyltransferase superfamily protein (.1) Potri.016G017100 [exp] 94 / 2e-23 AT3G21750 471 / 1e-163 UDP-glucosyl transferase 71B1 (.1) Potri.016G015800 [exp] 92 / 6e-23 AT1G07250 395 / 3e-134 UDP-glucosyl transferase 71C4 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0113 [flax] [poplar] GT-B PF00201 [flax] [poplar] UDPGT UDP-glucoronosyl and UDP-glucosyl transferase
Representative CDS sequence Show only first row Show all	>Lus10008248 pacid=23164917 polypeptide=Lus10008248 locus=Lus10008248.g ID=Lus10008248.BGIv1.0 annot-version=v1.0 ATGAACCCGATCTTAAGAACCGAAAAAAATTACTCGGATGCTCTGCCTCCAGGGTTCCTGGACAGAGTCAGGGGCTGGGGAATGGTGGTGCGAGGATGGG CCCCACAAAAGAGGATATTGGAGCACGAGAGCGTGGCGGGGTTCGCGAGTCACTGCGGGTGGAGCTCAGTGTTGGAGAGCATATGGTGCGGGGTTCTGAT CGTGGGGATGCCGATGTGGTCCGACGGGGCCGTGAACATGAGGTTGGTGGAGGAGATTGGGTTTGGGGTGGAGGTTAAGAAGGACGAGAATGACGAGTTT CAGAGGGATGAAATAGGGAAATTAATTAGGGAAGTGTACTAG
AA sequence Show only first row Show all	>Lus10008248 pacid=23164917 polypeptide=Lus10008248 locus=Lus10008248.g ID=Lus10008248.BGIv1.0 annot-version=v1.0 MNPILRTEKNYSDALPPGFLDRVRGWGMVVRGWAPQKRILEHESVAGFASHCGWSSVLESIWCGVLIVGMPMWSDGAVNMRLVEEIGFGVEVKKDENDEF QRDEIGKLIREVY

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G18560			UDP-Glycosyltransferase superf...		Lus10008248 [exp]	0	1
AT3G16857	GARP	ARR1	response regulator 1 (.1.2)		Lus10039345 [exp]	4.0	1.0000
AT5G67360		ARA12	Subtilase family protein (.1)		Lus10027891 [exp]	4.7	1.0000
AT2G21540		ATSFH3	SEC14-like 3 (.1.2.3)		Lus10040432 [exp]	7.9	1.0000
					Lus10003831 [exp]	8.9	1.0000
AT5G64790			O-Glycosyl hydrolases family 1...		Lus10005788 [exp]	10.0	1.0000
					Lus10006010 [exp]	11.0	1.0000
AT3G25810			Terpenoid cyclases/Protein pre...		Lus10010970 [exp]	11.6	1.0000
					Lus10010840 [exp]	12.6	1.0000
					Lus10023520 [exp]	14.1	1.0000
					Lus10006296 [exp]	14.2	1.0000

Compare expression of checked genes

Lus10008248 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.