Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G27070 102 / 1e-27 TSB2 tryptophan synthase beta-subunit 2 (.1) AT5G54810 102 / 1e-27 ATTSB1, TRP2, TRPB, TSB1 TRYPTOPHAN BIOSYNTHESIS B, TRYPTOPHAN BIOSYNTHESIS 2, tryptophan synthase beta-subunit 1 (.1) AT5G28237 102 / 2e-27 Pyridoxal-5'-phosphate-dependent enzyme family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018358 [exp] 114 / 1e-31 AT5G28237 555 / 0.0 Pyridoxal-5'-phosphate-dependent enzyme family protein (.1) Lus10007651 [exp] 112 / 2e-31 AT5G28237 483 / 4e-169 Pyridoxal-5'-phosphate-dependent enzyme family protein (.1) Lus10011154 [exp] 97 / 2e-25 AT4G27070 766 / 0.0 tryptophan synthase beta-subunit 2 (.1) Lus10043059 [exp] 97 / 2e-25 AT4G27070 766 / 0.0 tryptophan synthase beta-subunit 2 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G024900 [exp] 107 / 2e-29 AT5G28237 586 / 0.0 Pyridoxal-5'-phosphate-dependent enzyme family protein (.1) Potri.011G136000 [exp] 94 / 1e-24 AT5G54810 755 / 0.0 TRYPTOPHAN BIOSYNTHESIS B, TRYPTOPHAN BIOSYNTHESIS 2, tryptophan synthase beta-subunit 1 (.1) Potri.001G420300 [exp] 93 / 5e-24 AT4G27070 754 / 0.0 tryptophan synthase beta-subunit 2 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0063 [flax] [poplar] NADP_Rossmann PF00291 [flax] [poplar] PALP Pyridoxal-phosphate dependent enzyme
Representative CDS sequence Show only first row Show all	>Lus10008278 pacid=23173697 polypeptide=Lus10008278 locus=Lus10008278.g ID=Lus10008278.BGIv1.0 annot-version=v1.0 ATGGTGCAGGAGTTTCAGTCTGTGACTGGGAGGGAGACGCGGCGGCAGGCAGCGGAGAAGTGGGGCGGGAAGCTGGATGTCATTGTGGCATGCGTCGGGA GTGGGTCCAATGCTTTGGGGATGTTTCATGAGTTTGTTGTGGATTCAGAGGTGAGGTTGATCGGAATTGAGGCGGCAGGGTTCAGGTTGAACAGCTAG
AA sequence Show only first row Show all	>Lus10008278 pacid=23173697 polypeptide=Lus10008278 locus=Lus10008278.g ID=Lus10008278.BGIv1.0 annot-version=v1.0 MVQEFQSVTGRETRRQAAEKWGGKLDVIVACVGSGSNALGMFHEFVVDSEVRLIGIEAAGFRLNS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G28237			Pyridoxal-5'-phosphate-depende...		Lus10008278 [exp]	0	1
AT1G24590	AP2_ERF	ESR2, DRNL, SOB...	FOR SUPPRESSOR OF PHYTOCHROMEB...		Lus10017907 [exp]	1.4	0.8399
AT2G26975			Ctr copper transporter family ...		Lus10023045 [exp]	3.9	0.7814
AT4G30440		GAE1	UDP-D-glucuronate 4-epimerase ...		Lus10002511 [exp]	6.0	0.7908
AT3G28345		MDR13, ABCB15	multi-drug resistance 13, ATP-...		Lus10036616 [exp]	11.9	0.6311
AT2G27610			Tetratricopeptide repeat (TPR)...		Lus10020588 [exp]	16.4	0.6361
AT1G01470		LSR3, LEA14	LIGHT STRESS-REGULATED 3, LATE...		Lus10010140 [exp]	17.5	0.8237
AT1G16930			F-box/RNI-like/FBD-like domain...		Lus10023037 [exp]	17.7	0.7365
AT4G40070			RING/U-box superfamily protein...		Lus10035931 [exp]	19.9	0.7915
AT3G48480			Cysteine proteinases superfami...		Lus10031938 [exp]	26.3	0.5606
					Lus10035468 [exp]	27.1	0.6987

Compare expression of checked genes

Lus10008278 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.