Lus10008281 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G64720 361 / 2e-125 CP5 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
AT5G54170 282 / 1e-93 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
AT4G14500 269 / 1e-88 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1.2)
AT3G23080 267 / 1e-88 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1.2)
AT3G13062 108 / 3e-27 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1.2.3)
AT1G55960 103 / 2e-25 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10033247 448 / 2e-159 AT1G64720 523 / 0.0 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Lus10032938 299 / 3e-100 AT1G64720 437 / 2e-152 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Lus10041166 265 / 1e-86 AT4G14500 607 / 0.0 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1.2)
Lus10021883 255 / 5e-83 AT4G14500 605 / 0.0 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1.2)
Lus10033334 91 / 8e-21 AT1G55960 384 / 5e-132 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Lus10015566 86 / 2e-20 AT1G64720 105 / 5e-27 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Lus10000083 73 / 2e-15 AT3G23080 122 / 6e-33 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1.2)
Lus10034791 75 / 3e-15 AT3G13062 346 / 2e-115 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1.2.3)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G450100 382 / 3e-133 AT1G64720 489 / 6e-173 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Potri.011G151500 377 / 6e-131 AT1G64720 515 / 0.0 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Potri.012G021400 350 / 3e-120 AT1G64720 478 / 2e-168 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Potri.015G005000 347 / 6e-119 AT1G64720 474 / 1e-166 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Potri.008G162600 267 / 8e-88 AT4G14500 581 / 0.0 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1.2)
Potri.010G076500 267 / 9e-88 AT4G14500 571 / 0.0 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1.2)
Potri.007G002700 100 / 2e-24 AT3G13062 390 / 5e-134 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1.2.3)
Potri.014G001100 99 / 9e-24 AT3G13062 416 / 3e-144 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1.2.3)
PFAM info
Representative CDS sequence
>Lus10008281 pacid=23173704 polypeptide=Lus10008281 locus=Lus10008281.g ID=Lus10008281.BGIv1.0 annot-version=v1.0
ATGGTGAGGGACTTCTTCTGGGATGATGAGTTTCGAGCTAAGTGGGATGACATGCTTTTACATTCTGAAACTCTTGAGAAGTGTCCTACCACAGGAACCA
TGATGGTTCAGTGGGTTCGCAAGTTTCCTTTCTTCTGTAGCGACAGAGAGTACATCATTGGCCGCCGGATTTGGGAATCTGACAGAACATACTACTGTGT
CACCAAGGGAGTTCCATGTACTTCTGTTCCAAGGCGCAACAAGCCACGCCGTGTTGATCTCTACTATTCAAGCTGGTGCATTCGTGCAGCTGAATCAAAG
AGAGGAAATGGTCAGATGACTGCCTGTGAGGTGTTACTTTTCCATTACGAGGACATGGGCATCCCATGGGAGATTGCGAAACTCGGAGTGCGACAGGGAA
TGTGGGGAGCTGTCAAGAAAATCGAGCCAGGTCTACGAGCGTATCAGAAAGAAAGAGCGTCCGGAGCCCCACTTTCTCCTTGCGGTGCCATGGCTCAAAT
CAACACCAAAGTGACTCCAGACTACCTGGAGTCTCTAGATAGCAGCAGCAGTAGCAGCCGCATCACTAGTGATTCAACCGAGATTGAAACCACAGGTTCG
ACGGACAAAGCACAGAAGGGTTGCATACCAAGGATTCTAGTAGTTGGCGGAGCTATTGCTCTAGCGTGTACCCTTGATAAGGGACTCCTTACAAAGGCAG
TCATATTTGGAGTAGGTAGAAGGTTTGCCAAGATTGGGAGCAGATTCTGA
AA sequence
>Lus10008281 pacid=23173704 polypeptide=Lus10008281 locus=Lus10008281.g ID=Lus10008281.BGIv1.0 annot-version=v1.0
MVRDFFWDDEFRAKWDDMLLHSETLEKCPTTGTMMVQWVRKFPFFCSDREYIIGRRIWESDRTYYCVTKGVPCTSVPRRNKPRRVDLYYSSWCIRAAESK
RGNGQMTACEVLLFHYEDMGIPWEIAKLGVRQGMWGAVKKIEPGLRAYQKERASGAPLSPCGAMAQINTKVTPDYLESLDSSSSSSRITSDSTEIETTGS
TDKAQKGCIPRILVVGGAIALACTLDKGLLTKAVIFGVGRRFAKIGSRF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G64720 CP5 Polyketide cyclase/dehydrase a... Lus10008281 0 1
AT1G76080 ATCDSP32, CDSP3... ARABIDOPSIS THALIANA CHLOROPLA... Lus10005624 1.7 0.8648
AT1G64720 CP5 Polyketide cyclase/dehydrase a... Lus10033247 4.0 0.8255
AT3G23080 Polyketide cyclase/dehydrase a... Lus10000083 4.9 0.8438
AT4G23890 NdhS, CRR31 NADH dehydrogenase-like comple... Lus10003880 5.2 0.8235
AT2G30570 PSBW photosystem II reaction center... Lus10018771 11.9 0.8516
AT2G39730 RCA rubisco activase (.1.2.3) Lus10004708 16.3 0.8409
AT4G10810 unknown protein Lus10012620 16.3 0.7235
AT4G21860 MSRB2 methionine sulfoxide reductase... Lus10007105 23.1 0.7691
AT2G30570 PSBW photosystem II reaction center... Lus10024858 26.5 0.8448
AT1G58290 AtHEMA1, HEMA1 Arabidopsis thaliana hemA 1, G... Lus10042931 27.2 0.8208

Lus10008281 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.