Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G18196 246 / 3e-84 Heavy metal transport/detoxification superfamily protein (.1) AT4G10465 225 / 1e-75 Heavy metal transport/detoxification superfamily protein (.1) AT1G06330 103 / 2e-28 Heavy metal transport/detoxification superfamily protein (.1) AT3G56891 100 / 1e-26 Heavy metal transport/detoxification superfamily protein (.1) AT5G17450 89 / 8e-23 HIPP21 heavy metal associated isoprenylated plant protein 21, Heavy metal transport/detoxification superfamily protein (.1.2) AT1G71050 86 / 2e-21 HIPP20 heavy metal associated isoprenylated plant protein 20, Heavy metal transport/detoxification superfamily protein (.1) AT1G22990 85 / 4e-21 HIPP22 heavy metal associated isoprenylated plant protein 22, Heavy metal transport/detoxification superfamily protein (.1) AT4G08570 79 / 8e-19 Heavy metal transport/detoxification superfamily protein (.1) AT4G35060 79 / 1e-18 HIPP25 heavy metal associated isoprenylated plant protein 25, Heavy metal transport/detoxification superfamily protein (.1) AT4G38580 79 / 1e-18 HIPP26, ATFP6 HEAVY METAL ASSOCIATED ISOPRENYLATED PLANT PROTEIN 26, farnesylated protein 6 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10033250 [exp] 377 / 8e-136 AT2G18196 251 / 3e-86 Heavy metal transport/detoxification superfamily protein (.1) Lus10010147 [exp] 176 / 5e-56 AT2G18196 165 / 5e-52 Heavy metal transport/detoxification superfamily protein (.1) Lus10019676 [exp] 101 / 3e-27 AT4G39700 211 / 3e-71 Heavy metal transport/detoxification superfamily protein (.1) Lus10016436 [exp] 101 / 3e-27 AT4G39700 209 / 1e-70 Heavy metal transport/detoxification superfamily protein (.1) Lus10022508 [exp] 96 / 3e-25 AT4G39700 201 / 2e-67 Heavy metal transport/detoxification superfamily protein (.1) Lus10028531 [exp] 93 / 6e-24 AT5G17450 207 / 1e-69 heavy metal associated isoprenylated plant protein 21, Heavy metal transport/detoxification superfamily protein (.1.2) Lus10020704 [exp] 92 / 1e-23 AT1G06330 173 / 3e-56 Heavy metal transport/detoxification superfamily protein (.1) Lus10009115 [exp] 92 / 1e-23 AT5G17450 206 / 5e-69 heavy metal associated isoprenylated plant protein 21, Heavy metal transport/detoxification superfamily protein (.1.2) Lus10042946 [exp] 90 / 7e-23 AT1G71050 196 / 3e-65 heavy metal associated isoprenylated plant protein 20, Heavy metal transport/detoxification superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G452400 [exp] 271 / 8e-94 AT2G18196 256 / 3e-88 Heavy metal transport/detoxification superfamily protein (.1) Potri.011G149500 [exp] 263 / 7e-91 AT2G18196 257 / 9e-89 Heavy metal transport/detoxification superfamily protein (.1) Potri.006G024800 [exp] 132 / 8e-40 AT3G56891 167 / 5e-54 Heavy metal transport/detoxification superfamily protein (.1) Potri.011G065600 [exp] 119 / 1e-34 AT1G06330 159 / 7e-51 Heavy metal transport/detoxification superfamily protein (.1) Potri.019G106500 [exp] 101 / 1e-27 AT1G06330 217 / 1e-73 Heavy metal transport/detoxification superfamily protein (.1) Potri.007G087300 [exp] 99 / 1e-26 AT4G39700 215 / 9e-73 Heavy metal transport/detoxification superfamily protein (.1) Potri.019G107500 [exp] 97 / 1e-25 AT1G06330 213 / 5e-72 Heavy metal transport/detoxification superfamily protein (.1) Potri.017G123400 [exp] 96 / 1e-25 AT5G17450 220 / 4e-75 heavy metal associated isoprenylated plant protein 21, Heavy metal transport/detoxification superfamily protein (.1.2) Potri.010G114600 [exp] 96 / 3e-25 AT1G22990 194 / 9e-65 heavy metal associated isoprenylated plant protein 22, Heavy metal transport/detoxification superfamily protein (.1) Potri.005G079800 [exp] 94 / 1e-24 AT4G39700 189 / 2e-62 Heavy metal transport/detoxification superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00403 [flax] [poplar] HMA Heavy-metal-associated domain
Representative CDS sequence Show only first row Show all	>Lus10008284 pacid=23173733 polypeptide=Lus10008284 locus=Lus10008284.g ID=Lus10008284.BGIv1.0 annot-version=v1.0 ATGGGCTCAAGTGTGTTGGCGACAGCATTCAAGTCGATAATATCTGCGATTAGCTACTGTTACTTTAACTTGGGTGACGAACACGGCCTTCACTCCATCT CTGCTCCTATCAACCGAAGCAAGAAACACAAGGGCGCCGGCAAGACCAAGTCTCGCCCACTCTCCTTGCAGACGGTGGAGCTTAAAGTAAGGATGTGCTG CAGCGGGTGCGAGAGAGTGGTGAAGAGGGCCATTTACAAGCTCAGAGGAGTGGATTCGGTGGAGGTAGAGGTGGCGATGGAGAAAGTGACGGTGGTAGGG TACATAGAAAGGAACAAGGTCCTCAAGGCCATTAGGAGGTCCGGCAAAAGAGCTGAGTTTTGGCCGTACCCAAACCCGCCGCTCTACTTCACTTCCTCCA ACCATTACTTCAAGGACACAACCGCCGAGTTCAAGGACAGCTACAACTACTACCGCCACGGCTACAACCTCCCCCACCGCCACGGCAACGTCCCCGTCAC CCACCGCGGCGACGACAAGGTCAGCAACATGTTCAACGACGACAACGTCAACGCCACCTGCTCCCTCATGTGA
AA sequence Show only first row Show all	>Lus10008284 pacid=23173733 polypeptide=Lus10008284 locus=Lus10008284.g ID=Lus10008284.BGIv1.0 annot-version=v1.0 MGSSVLATAFKSIISAISYCYFNLGDEHGLHSISAPINRSKKHKGAGKTKSRPLSLQTVELKVRMCCSGCERVVKRAIYKLRGVDSVEVEVAMEKVTVVG YIERNKVLKAIRRSGKRAEFWPYPNPPLYFTSSNHYFKDTTAEFKDSYNYYRHGYNLPHRHGNVPVTHRGDDKVSNMFNDDNVNATCSLM

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G18196			Heavy metal transport/detoxifi...		Lus10008284 [exp]	0	1
AT5G64240		AtMCP1a, ATMC3	metacaspase 1a, metacaspase 3 ...		Lus10035630 [exp]	1.0	0.9808
AT5G17770		CBR1, ATCBR	NADH:cytochrome B5 reductase 1...		Lus10033405 [exp]	2.0	0.9730
AT1G69970		CLE26	CLAVATA3/ESR-RELATED 26 (.1.2)		Lus10010735 [exp]	2.4	0.9543
AT1G64230		UBC28	ubiquitin-conjugating enzyme 2...		Lus10027846 [exp]	3.5	0.9453
AT3G25855			Copper transport protein famil...		Lus10021687 [exp]	3.6	0.9321
AT3G45070			P-loop containing nucleoside t...		Lus10003070 [exp]	4.5	0.9542
AT2G30540			Thioredoxin superfamily protei...		Lus10040899 [exp]	6.3	0.9434
AT1G35470			SPla/RYanodine receptor (SPRY)...		Lus10020190 [exp]	7.4	0.9521
AT5G66900			Disease resistance protein (CC...		Lus10020779 [exp]	10.4	0.9378
AT1G13920			Remorin family protein (.1)		Lus10026649 [exp]	11.8	0.9447

Compare expression of checked genes

Lus10008284 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.